(data stored in ACNUC7421 zone)

EMBL: CP002157.PE379

CP002157.PE379       Location/Qualifiers
FT   CDS_pept        412382..412885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00580"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00580"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00116"
FT                   /db_xref="UniProtKB/TrEMBL:A4AV94"
FT                   /protein_id="EAR00116.1"
FT                   /translation="MLYKIFSYLKFIFTATNQHGVHSPFIYNFVTKCLYKKSKFKHPKT
FT                   FRVLLESCSYFNVKKISIIPKNMHVQSLIKNTYPQIDFNEQPYDIIYMDLPNTKMFNGI
FT                   LKNRLYHNNSMLLVKNIYQSKDSSQSWELIKSNVEITASIDMFHCGALFFRQEQTKEHF
FT                   KIRI"
     atgctctaca aaatcttctc atatttaaaa tttattttca cggcgaccaa ccagcacgga        60
     gttcattctc cgttcattta caatttcgtt acgaaatgtc tgtataaaaa atctaaattc       120
     aaacacccca aaacttttag ggttttactt gaaagttgct catatttcaa tgtgaagaaa       180
     ataagtatca tcccaaaaaa tatgcatgtt caaagtttga taaaaaatac ataccctcaa       240
     atagatttta atgagcaacc atatgatatc atttatatgg atttgccaaa taccaaaatg       300
     ttcaacggta tactcaaaaa tagattatac cataataata gtatgctatt ggttaaaaac       360
     atataccaaa gtaaagacag ttcgcaatct tgggaattaa ttaagagtaa tgtcgaaatc       420
     acggcttcta tagatatgtt tcattgcggg gctttattct ttagacaaga acaaacaaaa       480
     gaacatttta agattagaat ataa                                              504
//

If you have problems or comments...

PBIL Back to PBIL home page