(data stored in ACNUC7421 zone)

EMBL: CP002157.PE385

CP002157.PE385       Location/Qualifiers
FT   CDS_pept        419365..420579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00610"
FT                   /product="Signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00610"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00122"
FT                   /db_xref="GOA:A4AVA0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVA0"
FT                   /protein_id="EAR00122.1"
FT                   /translation="MSETAINQERLNDKIKLVLKVNYFSSALALCFGIACYFLLGITEI
FT                   IPYAFIAFGIANLINTFLFQKHKSLTTTYNITSVLALISTLIITLYSGGISSPFIFILA
FT                   LIVFAGYVTTRKYGQIYLNLIFFLIILVYSQSLPEFSFTHNVIPSESLDVFGLCSVLFA
FT                   VYLLGHVFGKNLLRTHHALYRSKNQLQKRINEKETLLKEVHHRVKNNLQTVSSLLSLQT
FT                   RSIEDDKMKNIIKSSQNRVISMAMVHEMLYMRDDLSKIEYKTYVKELSEYLIRSLKGAE
FT                   NNITLNIDIADIKLGIDTAIPLGLLINEAITNALKYGIVDDNEGEINIAIKKEPNNEYV
FT                   LNIGDNGIGFDDTIDHKTTKSLGLKLIHNLARQLKGSISKDHSKKGTNYIVKFTEVGQE
FT                   FRSIV"
     atgtctgaaa ccgcgattaa tcaagagcga ttgaatgata aaattaaatt ggtcttaaag        60
     gtcaattatt ttagttctgc acttgcttta tgttttggga tagcttgtta ctttttatta       120
     ggtattacgg agataatacc ttacgcattt atagcttttg gtatagctaa tttgattaat       180
     acctttttat ttcaaaagca taaatcctta acaacaacat ataacatcac ctctgtactt       240
     gcacttatca gcactttgat cataacatta tacagtgggg gtatttccag tccatttatt       300
     ttcattttgg cacttattgt atttgcaggt tatgtaacta ccagaaaata cgggcagatt       360
     tatttaaact taattttctt tctgataata ttggtttatt cacaaagcct tcccgaattt       420
     agttttacac acaatgttat tccttcagaa tcgctagatg tttttggctt gtgcagtgtg       480
     ctttttgctg tttatcttct tggccatgtt tttggaaaaa acctcttgcg cacgcaccat       540
     gccctatata gatcaaaaaa ccaattgcaa aaaagaatta atgaaaagga gacacttttg       600
     aaggaagtgc accatcgtgt aaaaaacaat cttcagaccg tatctagttt gttaagccta       660
     caaacgagga gtatagagga tgataaaatg aaaaatatca ttaaaagtag tcagaacagg       720
     gtcatttcca tggcaatggt tcatgagatg ctatatatgc gggatgattt atctaagatt       780
     gagtataaaa catatgtaaa agaactaagc gaatatctga tacgctcatt aaaaggagcg       840
     gagaacaaca taacgcttaa catagatatt gctgatataa aattggggat tgatactgca       900
     attcccttag gtttattaat caatgaagct attacaaacg ctcttaagta tggaattgtt       960
     gacgataatg aaggtgaaat aaatatcgct attaaaaaag aacccaataa cgaatacgta      1020
     ttgaatattg gtgataacgg tattggattc gatgatacaa tagatcataa aaccacaaag      1080
     tcattaggat taaaactaat acacaacttg gcacgccaat taaaaggttc tataagcaag      1140
     gaccattcca aaaaaggcac gaattacatt gtaaaattta ctgaagttgg gcaagaattt      1200
     cgctcaatcg tttaa                                                       1215
//

If you have problems or comments...

PBIL Back to PBIL home page