(data stored in ACNUC7421 zone)

EMBL: CP002157.PE387

CP002157.PE387       Location/Qualifiers
FT   CDS_pept        423283..424803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00620"
FT                   /product="Amidohydrolase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00620"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00124"
FT                   /db_xref="GOA:A4AVA2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVA2"
FT                   /protein_id="EAR00124.1"
FT                   /translation="MNITAQSAAGDGPHTQLIIRGVMLINGNGAPPQGPIDIVVENNII
FT                   KKIQVVGYPGVAIKDSSRPKLKAGGKELDCTGMYLLPGFVDMHGHIGGTSQGADSEYVF
FT                   RLWMSHGITTVREPSGRGVDYTLDLKRKSAKNEIVAPRILAYTGFGQGNGGPITTAEMA
FT                   REWVRDNAKKGADGIKFFGAEPEIMDAALRENKKLGLRSACHHAQLNVARWNVLHSARA
FT                   GLTSMEHWYGLPEALFEDRTIQNYPLDYNYNNEQHRFEEAGRLWKQAAKPYSEHWNAVM
FT                   DELLALDFTLDPTFNIYEASRDLQRARRAEWHEEYTLPSLWEFYQPSKISHGSYWHDWG
FT                   TEQEVAWKENYRLWMTFVNEYKNRGGRVTAGSDSGFIFQLYGFAYVRELELLREAGFHP
FT                   LEIIRSATLNGAEALGMGDKIGSVTVGKFADFVVVEENPLKNLKVLYGTGAVKLTEDNE
FT                   VVRVGGVKYTIKDGIVYDAKALLKEVKEMVDTEKKNKHYKILQPGIKE"
     atgaacatta ctgcacaaag cgctgcagga gatggtcctc acacccaact gattattaga        60
     ggagtaatgc ttattaatgg aaatggtgca ccgccacagg gacccataga cattgtggtc       120
     gagaataaca taataaaaaa aattcaggtc gtgggttatc ctggcgtggc cattaaggat       180
     tctagcaggc caaaattgaa agccggtgga aaagaacttg attgtactgg catgtattta       240
     ttgcctggat ttgttgatat gcacgggcac attggcggaa cctcacaagg cgctgattct       300
     gagtacgtat ttagattatg gatgagtcat ggtattacca ctgttcgtga gcctagcggc       360
     cgtggagttg attacacatt ggatttaaag cgaaaaagtg ctaagaacga aattgtagcg       420
     ccacgcatat tggcttatac aggatttggt caaggaaacg gcggtccaat tacaactgct       480
     gagatggcac gcgaatgggt acgtgataat gcaaaaaaag gcgcagatgg tataaagttt       540
     tttggggctg aaccagaaat tatggatgcg gctctgcgag aaaataaaaa gttaggactc       600
     cgttctgctt gtcaccatgc acaactgaat gttgcccgtt ggaatgtttt acattctgca       660
     agagcaggat taactagtat ggagcactgg tacggtttgc cagaggcttt atttgaagat       720
     aggaccattc agaactatcc gttggactat aattataaca atgagcagca cagatttgaa       780
     gaagccggtc gtttatggaa acaggctgct aaaccatatt ccgagcattg gaatgctgtt       840
     atggatgagc ttttggcctt agatttcacc ttagacccta cctttaatat ttatgaggcc       900
     agtcgcgatc tacaacgtgc tagaagggct gaatggcatg aagagtatac cctgccatcg       960
     ctctgggagt tttatcaacc aagtaaaatt tcacacggat cttactggca cgattggggt      1020
     acagagcaag aagtggcttg gaaagagaac tatagattgt ggatgacctt tgtaaatgag      1080
     tataaaaatc gcggtggtcg tgtaactgca ggatctgatt ctggatttat ttttcaactg      1140
     tatggctttg cctatgtgcg cgaattggaa ctattacgtg aggcaggttt ccatcccttg      1200
     gagattattc gttcagcaac acttaatggt gcagaagctt tgggtatggg agataaaata      1260
     ggaagtgtta cagttggtaa gtttgcagat tttgttgtgg ttgaagagaa cccgctaaag      1320
     aacttaaaag tgttatatgg aacaggcgca gttaaactga ctgaagataa cgaagtagta      1380
     cgtgtaggtg gtgttaaata cactattaag gacggtatag tttatgatgc caaggctttg      1440
     ttaaaagaag ttaaagaaat ggtcgatacc gaaaagaaaa ataaacacta taagatttta      1500
     caaccaggta tcaaggagta g                                                1521
//

If you have problems or comments...

PBIL Back to PBIL home page