(data stored in ACNUC7421 zone)

EMBL: CP002157.PE393

CP002157.PE393       Location/Qualifiers
FT   CDS_pept        complement(428331..428708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00650"
FT                   /product="Glyoxalase/dioxygenase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00650"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00130"
FT                   /db_xref="GOA:A4AVA8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVA8"
FT                   /protein_id="EAR00130.1"
FT                   /translation="MNLNQVTVPSLDLEKSIPFYKKLGLKLIVEALPHYARFECPDGDS
FT                   TFSIHLVKELPKGDGVYIYFECNDLDAQVDELRVNGIEFKEMPSDRRWLWREARLKDLD
FT                   GNNLILFYGGENRKNPPWRLS"
     atgaacctta atcaggtaac tgtaccctct ttagacttgg aaaaatcaat tcctttctat        60
     aagaaattag ggttaaagtt aattgttgag gccttaccac attatgcacg atttgaatgc       120
     ccagacgggg attcgacctt ttctattcat ttagttaaag aattaccaaa aggtgatggc       180
     gtttacattt attttgaatg taatgattta gatgctcagg tggatgaatt acgtgtaaat       240
     ggaatcgaat ttaaggaaat gccctcagac agaaggtggc tttggcgaga agctcgttta       300
     aaggacttgg atggcaataa cctgattctt ttttatggtg gggagaatag gaaaaatcct       360
     ccttggcggt tgtcataa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page