(data stored in ACNUC7421 zone)

EMBL: CP002157.PE396

CP002157.PE396       Location/Qualifiers
FT   CDS_pept        429956..430687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00665"
FT                   /product="peptide methionine sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00665"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00133"
FT                   /db_xref="GOA:A4AVB1"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVB1"
FT                   /protein_id="EAR00133.1"
FT                   /translation="MAVSKFKNHQQSLKLKSSMYKITLLAFAILFSISCESKVKNSIKD
FT                   TAKSNVEKPVKLSLNDLQEYEVAYFASGCFWCVEAIYEDVIGVKEVISGYSGGTESNPT
FT                   YEQVGRGLTSHAEAVKVFYNPKEIDFKTLVKVFFGSHDPTTLNRQGPDHGPQYRSIAFY
FT                   SNESEKKIIEEYIAQLKNEEVYSSPIVTQVEKFVKFYDAEDYHQDYERLNPNNPYIINI
FT                   SIPRYKRFQAKYPELMKKSGH"
     atggcagtaa gtaaattcaa gaatcatcaa caaagcttaa aacttaaatc aagtatgtat        60
     aaaatcaccc ttttggcttt tgccattttg ttttcgatta gttgtgaatc caaagtaaaa       120
     aacagcatta aagataccgc taaaagcaat gttgaaaaac ctgtaaaact ttcattaaac       180
     gatttacaag aatatgaagt cgcttatttt gcgagtggat gtttttggtg tgttgaagca       240
     atttatgaag acgtaattgg tgtgaaagaa gttatctctg gctattctgg aggtactgag       300
     tccaatccca catatgagca agttggtcgt ggattaacga gtcatgcaga agcagtcaaa       360
     gtattttaca acccaaaaga gatcgatttc aaaactttgg ttaaagtgtt ctttggctct       420
     cacgacccta caaccttaaa tcgtcaaggt cctgaccacg gaccgcaata ccgctctatt       480
     gctttttatt ccaatgaatc tgagaaaaaa atcattgaag aatatatagc tcaattaaag       540
     aatgaggagg tatacagcag tccaatagta acgcaagtcg aaaaattcgt aaagttctat       600
     gatgcggaag attatcatca agattatgaa agactgaatc caaacaatcc gtatataatt       660
     aatatttcta ttcccagata taaaaggttt caggcaaaat accctgagtt aatgaaaaaa       720
     tcaggacatt ag                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page