(data stored in ACNUC7421 zone)

EMBL: CP002157.PE397

CP002157.PE397       Location/Qualifiers
FT   CDS_pept        430796..432181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00670"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00670"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00134"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVB2"
FT                   /protein_id="EAR00134.1"
FT                   /translation="MKLPKIYRFNLLYLLIGFLLFSCSQTKKDNTPWVEIFDGETLNGW
FT                   TQKGGEANYTVREGSIVGSTIHDTPNSFMTSDKMYGDFILELEYLVDSTMNSGIQIRSN
FT                   SYPHYMHGRVHGYQIEIDPSDRAWSAGIYDEGRRGWLNNLIDNPDAQKGFKQNDWNHYR
FT                   IEAIGDTLKTWINGIPAAHLIDDKTASGFIGLQVHSIGKDKKEGTEIIWKNIKILTDSL
FT                   SKYSKTTPLEPIITTNKVAVDEIKNGWQMLWDGKTTNGWRGARLDEFPENGWEITNGIL
FT                   TVLPSGGEESAAGGDIVTKEVYGDFELKVDFKITEGANSGIKYYVDTDLNKGPGSSIGL
FT                   EYQILDDARHPDAKKGNHEGSRTVASLYDLIQAATDKPVNPIGEWNTAHIISKDNQVEH
FT                   RLNGMTVLKYERKSDSYKKLVSESKYVKWPNFGEVEKGHILLQDHGDRVSFKNIKIKPI
FT                   IKK"
     atgaaactac caaaaatcta tcgctttaat cttctttacc tattaatcgg atttttactt        60
     ttcagttgct cacaaaccaa aaaagacaac acgccttggg tagaaatctt tgatggagaa       120
     acattaaatg ggtggaccca aaaaggtgga gaggccaatt acaccgttcg agagggatct       180
     attgttggaa gtaccattca tgatacaccc aactcattta tgacctctga caaaatgtat       240
     ggcgatttta ttttggaact ggagtatttg gttgattcca ctatgaattc aggcattcaa       300
     atacgtagca acagctaccc tcactatatg catggcaggg tgcacggcta tcaaatagaa       360
     atagacccat cagaccgcgc ctggagtgca ggcatctatg atgagggaag aagaggttgg       420
     ttgaacaacc ttattgataa tcctgatgcg caaaaaggtt tcaagcaaaa tgattggaac       480
     cattatcgta tcgaagctat tggtgatact ctaaaaacgt ggatcaacgg gattcccgca       540
     gctcatttga tagacgataa aacagcaagc ggctttattg gattacaagt tcacagcatt       600
     ggaaaagata aaaaagaagg aaccgaaatt atctggaaaa acatcaaaat acttacagat       660
     agcttgtcaa aatactccaa aacaacacca ttagaaccga taataacaac aaacaaagtt       720
     gctgttgacg aaataaaaaa cggatggcaa atgctttggg atggaaaaac cacaaatgga       780
     tggaggggtg ctcgcctaga tgagtttcca gagaacggtt gggaaataac caatggcata       840
     ttgaccgttc ttccttctgg aggagaagaa tctgcagcag gaggagatat tgtaactaaa       900
     gaagtttatg gtgattttga actcaaggtg gattttaaaa tcactgaggg cgccaatagc       960
     ggaataaagt attatgtaga tactgatttg aacaagggac caggttcttc aatcggatta      1020
     gaatatcaaa ttttggatga tgctcgtcac ccagatgcta aaaagggaaa tcatgagggt      1080
     agtcgtacag tagcatctct ttatgattta atacaggccg caacagataa acctgtcaat      1140
     cctattgggg aatggaatac tgcccatatt atttcgaaag acaaccaagt cgaacacagg      1200
     cttaacggaa tgacagtttt aaaatatgaa cgtaaaagcg attcctataa aaaattggtg      1260
     tctgaaagta agtatgtgaa atggcccaat tttggagaag ttgaaaaagg acacatttta      1320
     ttgcaagacc atggggatcg agtaagtttc aagaatatca aaataaaacc aatcattaaa      1380
     aaataa                                                                 1386
//

If you have problems or comments...

PBIL Back to PBIL home page