(data stored in ACNUC7421 zone)

EMBL: CP002157.PE407

CP002157.PE407       Location/Qualifiers
FT   CDS_pept        complement(440876..442534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00720"
FT                   /product="dolichyl-phosphate-mannose-protein
FT                   mannosyltransferase-family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00720"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00144"
FT                   /db_xref="GOA:A4AVC2"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVC2"
FT                   /protein_id="EAR00144.1"
FT                   /translation="MISNTRYWFLMAMIVLVYIAGMFVTLFENDSAQFAVMAMRMVQEN
FT                   DFLSLFKGPGEYLDKPHMHYWLAALSFKIFGLFEWAYRIPAILATLLGAYSCFGLGKLL
FT                   YNQNVGKLAALIFMTSQTIVLGVIDVRTDAVLTGFAVFSIWHLAVYIEKNSLKHMILGT
FT                   IGAGIAFSTKGQIALLVIGLPILCHLGYTRQWKMFLNWRVLVGLIVFALVITPMLYAYY
FT                   HQFDLHPEKIIRGKGNRSGIFFIFWEQSFERLSGEGVGKNSSDYFFFFHTFLWVFLPWT
FT                   VVGLLAYWNKVKNMIRTKFRFNSENEVLTLGGITLIFIIISFAQFKLPHYLNIVMPLFA
FT                   VLSASYLYKLYKEGDQPLKKVLLGFQYLVLAVIFIATVFICFFVFKADSYYNFIWKGVL
FT                   AVLIVYYCLKREDYYFRIITVGVMSSVLLNGVLNTHFYPTLLEYQAGSTMSKTIKEQNI
FT                   PVDNIYKISGNHTWGLDFYNQHPVKITSIEDLKQQQGLWVYANDKELISMKKEGLDWDK
FT                   QLSEKQFRITRLQAKFLDPSTRKKVLNKMHLIHIR"
     atgatttcga acaccaggta ttggttttta atggcaatga ttgttctagt ttatatcgct        60
     ggaatgttcg tcacactctt cgaaaatgat tctgcccaat ttgcggtcat ggcaatgcgc       120
     atggttcaag agaatgattt tcttagcctg tttaaaggac ccggggagta tttggataag       180
     ccacatatgc attattggtt ggctgcactt tcgttcaaga tatttgggtt gtttgaatgg       240
     gcatatcgca ttcctgctat tctagcaacc ttgttaggag catatagttg ttttgggttg       300
     ggtaagttac tttacaatca aaatgttggc aaacttgcgg ctttgatttt catgacatca       360
     caaaccattg ttttgggagt aatcgacgtt cgtaccgatg ccgtacttac tggatttgct       420
     gttttttcta tatggcattt ggctgtttat atagaaaaga attcactcaa gcatatgata       480
     ttgggtacta ttggtgccgg tatagctttt tcaacaaaag gacagattgc acttttggtc       540
     attggactac ctattctatg ccatttggga tatacccggc agtggaagat gttcctcaat       600
     tggcgagtgt tagtagggct gattgttttc gctctagtga ttaccccgat gctttatgcc       660
     tattaccatc aatttgatct gcaccccgag aagatcatac gtggaaaagg gaatcggagc       720
     gggatattct ttattttttg ggaacagagt tttgagcgcc taagtggaga aggggtaggg       780
     aagaatagta gtgattactt cttctttttt catacttttt tatgggtctt tttaccatgg       840
     actgtagtgg ggttacttgc ctactggaat aaggtaaaaa acatgattag aactaagttc       900
     aggttcaact ctgaaaacga ggtcctgact ttagggggaa ttactttgat tttcatcatc       960
     attagttttg cccaatttaa attaccacat tacctaaata ttgtcatgcc attgtttgca      1020
     gtgctatctg cgtcctacct atataaactc tataaagaag gtgaccagcc attaaaaaag      1080
     gtacttttgg gatttcaata tcttgtgctt gcagttattt ttattgccac tgtctttatc      1140
     tgcttcttcg tatttaaagc agattcctat tataacttta tttggaaagg agtactagcc      1200
     gttttgattg tttattattg ccttaaacga gaagattatt actttagaat cataactgtt      1260
     ggagtgatga gttcagtttt gttaaacgga gttttaaata cgcattttta tccaacttta      1320
     ttggaatatc aggctggttc aactatgtct aaaactatta aagagcaaaa cattcctgtt      1380
     gataatattt acaagatatc agggaaccat acttggggtt tggattttta caatcaacat      1440
     cctgtaaaga ttaccagtat agaagatttg aaacaacaac aaggtttatg ggtatatgcc      1500
     aatgataagg aattgatctc tatgaaaaaa gagggtttgg attgggataa acaactatct      1560
     gaaaaacaat ttaggattac aagattacag gctaagtttt tagatccctc tacacgtaaa      1620
     aaagtgctta ataaaatgca cttgattcat attcgttaa                             1659
//

If you have problems or comments...

PBIL Back to PBIL home page