(data stored in ACNUC7421 zone)

EMBL: CP002157.PE408

CP002157.PE408       Location/Qualifiers
FT   CDS_pept        complement(442531..443100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00725"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00725"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00145"
FT                   /db_xref="GOA:A4AVC3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVC3"
FT                   /protein_id="EAR00145.1"
FT                   /translation="MLEELIQLDKEVFLFLNNLGNPIWDGFWMFVTNKLSSIPVYLLLL
FT                   TLIYKHLGLRKTFIVLLTIGLLILVTDQLANFFKYGVERLRPCYDQDVNEIMRLVKNSC
FT                   GGRFGYFSAHAANSFAVASFFTFLLKSKYRFIGTLLFLWALMVAYSRIYIGVHFPLDVL
FT                   TGICIGLGLSWLFSKLYIFALHKYQL"
     atgttggaag agctcattca acttgataaa gaggtattct tatttcttaa taatttaggt        60
     aaccccatct gggatggctt ttggatgttc gttaccaata agttgagttc aattcctgta       120
     tatcttcttt tgttgactct aatctataag cacctagggc taagaaaaac cttcattgta       180
     cttcttacaa tagggttatt gattctcgtt acggatcaat tggccaattt ttttaaatat       240
     ggggttgagc gcttaagacc ttgttatgat caagatgtta atgaaattat gcgtttggtg       300
     aagaactctt gtggtggtag gtttggttat ttttcggccc atgcggcgaa ttcttttgca       360
     gtagcttctt tcttcacctt tttattaaaa tccaaatata ggtttattgg tactttactt       420
     ttcttatggg cacttatggt agcctatagc agaatttata taggagtaca ttttccgctg       480
     gacgtattaa caggaatctg tattggatta gggcttagtt ggctcttttc caagttgtat       540
     atatttgcac ttcacaaata ccaactatga                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page