(data stored in ACNUC7421 zone)

EMBL: CP002157.PE411

CP002157.PE411       Location/Qualifiers
FT   CDS_pept        complement(444855..445628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00740"
FT                   /product="MazG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00740"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00148"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR011551"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVC6"
FT                   /protein_id="EAR00148.1"
FT                   /translation="MNSRASQLKAFDRLLTIMDELREQCPWDKKQTMQTLRHLTIEETY
FT                   ELGDAILKNDLEEVKNELGDLLLHIVFYSKIGSETNDFDVADVCNSICEKLINRHPHIY
FT                   GDVEVANEDEVKQNWESIKLKEGKKSVLEGVPNGLPALVKANRIQDKVAGVGFDWEKPE
FT                   QVFEKVQEELSELQTEIKSGNPDKVEAEFGDVLFSMINYARFLNVNPDNALERTNKKFI
FT                   SRFQYLETKAKETGKSLKDMTLAEMDIYWEEAKSI"
     atgaattcta gagcatcgca actaaaggca tttgatcgtt tattgactat aatggatgaa        60
     cttcgggagc aatgtccgtg ggataaaaag cagaccatgc agaccttgcg gcacctgaca       120
     attgaagaga cctatgagct tggagatgct attttgaaaa atgacttgga ggaggtcaaa       180
     aatgagttgg gagacctttt gttgcacatt gtgttctatt cgaagattgg ttcggaaact       240
     aatgattttg acgtagctga tgtatgcaac agtatatgcg aaaaactcat caacaggcac       300
     ccacatattt atggcgatgt agaagtggca aatgaggatg aggttaaaca gaattgggaa       360
     agcataaaac taaaagaggg taaaaaaagt gttttagagg gagttccaaa tgggttgcca       420
     gccctagtta aggctaatcg cattcaggac aaagtagcag gggttggttt tgattgggaa       480
     aagcccgaac aagtattcga aaaggtgcaa gaagaactat cagaacttca aactgaaatt       540
     aaatccggta atcctgataa agttgaagca gagtttggcg acgtactttt ttccatgatc       600
     aactatgcac gttttttgaa cgtaaatcca gacaatgcct tggagcgcac caataagaaa       660
     ttcataagta ggtttcaata tttggaaaca aaagcaaaag aaacaggtaa gagtttaaaa       720
     gatatgaccc tggccgaaat ggatatctac tgggaagaag ctaaatctat ttaa             774
//

If you have problems or comments...

PBIL Back to PBIL home page