(data stored in ACNUC7421 zone)

EMBL: CP002157.PE433

CP002157.PE433       Location/Qualifiers
FT   CDS_pept        466303..466986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00850"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00850"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00170"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVE8"
FT                   /protein_id="EAR00170.1"
FT                   /translation="MKIVILAAGIGSRLGNPFPKPLTPLNNGKSIMGMQISNLTTHFNV
FT                   DDISIVVGFKKDLIMERFPEVTYIYNPFFDRTNTSKSLLQALKKNKDKSVLWLNGDVVF
FT                   DSKLLDELKPYLNNDQSFVAVNTSKVAEEEVKYTLKDNYIHELSKTVKNGLGEAVGINF
FT                   IASKDIQSFIDCLEECDDNDYFERGLELAIEKDNIQITAVDISAFDCMEVDFKEDLENA
FT                   NNLFR"
     atgaaaatag ttatccttgc tgcaggaata ggttctagac tgggcaatcc ttttccaaaa        60
     ccacttaccc ctttgaacaa tggcaagagt ataatgggga tgcaaataag taatctcact       120
     acacatttta atgtagatga tattagtata gtagttggtt tcaagaaaga tttaatcatg       180
     gagcgctttc ccgaagttac ttatatttac aatcctttct ttgatcgtac aaatacttca       240
     aaaagtctac tgcaggcctt aaaaaagaac aaggacaaat ctgttctatg gttgaatgga       300
     gatgttgttt ttgattccaa attattggat gaactaaaac cttacttaaa taatgaccaa       360
     tcgtttgtgg cggtaaacac cagtaaggtg gctgaagaag aggtaaaata caccttaaaa       420
     gataactata tccatgaact ttccaagaca gtcaagaacg gcttgggtga ggccgtgggg       480
     ataaatttca ttgcatcaaa agacatacag agcttcattg attgcttaga agagtgcgat       540
     gataatgact attttgaacg tggcctagaa ctcgctattg aaaaagacaa tattcaaatc       600
     actgctgttg acatctctgc ttttgattgt atggaggttg attttaaaga agatttggaa       660
     aatgccaata acctctttcg ttga                                              684
//

If you have problems or comments...

PBIL Back to PBIL home page