(data stored in ACNUC7421 zone)

EMBL: CP002157.PE434

CP002157.PE434       Location/Qualifiers
FT   CDS_pept        466986..468818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00855"
FT                   /product="CDP-Glycerol:Poly(glycerophosphate)
FT                   glycerophosphotransferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00855"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00171"
FT                   /db_xref="GOA:A4AVE9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007554"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVE9"
FT                   /protein_id="EAR00171.1"
FT                   /translation="MKVILFCQNAYAFGILAPIRDLLTSSSHDYIWFVSKKILQAFPFK
FT                   TENYTSSILDLQFFDSDAIFIPGNEVPYYLKGLKVQVFHGLAGEKKGHFRIRHYFDLYL
FT                   TQGPFFTSKFNELKEKHQDFDVIETGWPKLDVYGKHKNSFDSEKKVVLDRYNTTTMVLY
FT                   APTFSPSLTSAPFLLNEMEELAVNTGYLIYIKFHDLMSAEWITAYAELSHRIPNIIFQK
FT                   EKNIIKFLLQADILISDTSSVIYEFLLLDKPVVSFKNISGNIQWDDSQSYSNLTQRVEN
FT                   NLNNDPFKKERQSIYAAYHPYNDGQSAERMISAVEKYISKNGVPEKRNLSFARQLKIHK
FT                   IFGQPVLEPWTGEKTEKITALLITFNEINNIEEVLENVSFANEIIVVDSFSSDGTVDKI
FT                   KEYPKVKLIQRAFKNYTDQKSFAMEQASNDWVLFMDADERLTDGLKNEILKTINSKSNT
FT                   IVAFMFSRTFMFKNKILRFSGWQSDKNYRLFRKTKVKFDNDLIVHESLIVNGESGVMKN
FT                   KLIHYSYSDYEDYKAKMIKYGQMKAAEEFKKNKNSYPHHFVLRPVYKFLNHYIIRLGIL
FT                   DGKKGIIICYLNALGVYSRYKELKRLRKQGKLSS"
     atgaaggtta tattgttttg tcagaatgct tatgcatttg ggattttggc gcccattcgc        60
     gacttattaa cgtcttcttc ccatgattat atttggtttg tatctaaaaa aatacttcag       120
     gcttttccat tcaaaaccga gaattacact tcaagcattt tagacttaca attttttgat       180
     agtgatgcga tttttattcc tggtaatgag gtgccatatt atttaaaagg gttgaaagtc       240
     caagtttttc atggcttggc aggagaaaag aaaggacact ttagaataag gcattacttt       300
     gatctgtatt tgacccaagg accatttttt acttccaaat tcaatgaact aaaggaaaaa       360
     catcaagatt ttgatgttat tgagactggt tggccaaagt tggacgttta cggcaaacat       420
     aaaaactcat ttgattcgga aaagaaggta gtattggatc ggtacaatac aactacaatg       480
     gtactttatg cccccacttt ttcaccaagt ctaacatctg ctccttttct attgaacgaa       540
     atggaggaat tagcggtaaa caccggttat cttatttata tcaagttcca tgatctgatg       600
     agtgctgagt ggattactgc ctacgcagaa ttaagccacc gaatacccaa tatcattttt       660
     caaaaagaaa aaaatatcat caagttctta cttcaggcag atatattgat tagcgatact       720
     tcatccgtta tctacgagtt tcttttattg gacaaaccag tagtatcgtt caaaaatata       780
     tctgggaata ttcaatggga cgactcccaa tcctattcta atctgactca aagggttgag       840
     aacaacctga acaatgaccc gtttaaaaaa gaacgacaat caatctatgc agcataccat       900
     ccttacaatg acggtcaatc ggcagagcgt atgatttcgg ctgttgaaaa gtatatttcc       960
     aagaacggag taccggaaaa aagaaatcta tcttttgccc gtcaacttaa gattcataag      1020
     atttttggac aaccagtctt agaaccttgg acgggtgaaa aaacagaaaa aataacggca      1080
     ctattgatta ctttcaatga gatcaataac attgaagaag tactggaaaa cgtaagcttt      1140
     gccaatgaaa tcattgttgt ggactctttc agttctgatg gcaccgtgga taaaatcaag      1200
     gaatacccaa aagtgaaatt gattcaaagg gcatttaaga actatacaga ccaaaaatct      1260
     ttcgctatgg agcaggcctc taatgattgg gtcttgttca tggatgccga tgaacgtttg      1320
     actgacggtc ttaaaaatga aatcctaaaa accattaact caaaatcaaa tactattgta      1380
     gcgtttatgt tttcaagaac attcatgttc aagaataaaa tattgcgctt tagcggatgg      1440
     cagagcgata agaattaccg cttgttccgt aaaaccaagg tcaaatttga taatgacctt      1500
     atagttcatg aatccttgat tgtgaatggt gaatcgggag taatgaaaaa taagctaatt      1560
     cattattcat atagtgatta tgaggattac aaagcgaaaa tgatcaaata tgggcaaatg      1620
     aaggccgccg aggaatttaa aaagaataaa aatagttatc ctcatcattt tgtgcttaga      1680
     ccggtatata aatttttaaa ccactatatt attagattag gtattcttga tggaaaaaaa      1740
     ggcatcataa tttgctatct gaacgctttg ggggtttatt ctagatataa agaattaaag      1800
     agattaagaa aacaaggaaa gttatcgagt tga                                   1833
//

If you have problems or comments...

PBIL Back to PBIL home page