(data stored in ACNUC7421 zone)

EMBL: CP002157.PE435

CP002157.PE435       Location/Qualifiers
FT   CDS_pept        468818..469387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00860"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00860"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00172"
FT                   /db_xref="GOA:A4AVF0"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVF0"
FT                   /protein_id="EAR00172.1"
FT                   /translation="MSDFTAEINSCIKVLSEGGLILYPTDTVWGIGCDATKEEAVQKVY
FT                   ALKQREDSKALISLVANDAMLERHVEQVPEVAYEILDLATKPTTIIYDNPKGLAPNVIA
FT                   QDNTMAIRVASDKFCQYLINKFRKPIISTSANVTGQSTPKSFSEISEPILKGVDYIVNL
FT                   EHDKKNESASSIIKLSNDGTVKVIRQ"
     atgagtgatt ttactgcaga aataaatagt tgtattaagg tattgtcaga gggtggactc        60
     atcctctacc ctaccgatac ggtttggggc attggttgcg atgcgacgaa agaagaagca       120
     gtacaaaagg tatatgccct aaaacaacgt gaagattcaa aagcactaat aagtttagtg       180
     gcgaatgatg ccatgcttga aaggcatgtt gagcaagtac cagaagtagc ttacgagata       240
     ttggatcttg caaccaaacc aacaaccatc atctacgata atcccaaagg tttggcgcca       300
     aatgtaattg cccaagataa caccatggca attagagtgg catctgataa attctgtcaa       360
     tatttaatca acaagtttag aaaacccatt atttccacct cggcaaatgt tactggtcaa       420
     tcaactccta aaagcttttc tgaaataagc gaacctattt taaaaggtgt tgactatatt       480
     gtaaatttgg agcatgataa aaaaaatgaa tcagcctctt ccattattaa attaagtaat       540
     gatggtacgg tcaaagtgat tcgtcaataa                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page