(data stored in ACNUC7421 zone)

EMBL: CP002157.PE442

CP002157.PE442       Location/Qualifiers
FT   CDS_pept        475614..476447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00895"
FT                   /product="excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00895"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00179"
FT                   /db_xref="GOA:A4AVF7"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVF7"
FT                   /protein_id="EAR00179.1"
FT                   /translation="MLRLLQIEFIKLWNNRVSKILIISYFVLLTSIALVAAIKFDIGPI
FT                   KFHLAEQGIFNFPYIWHFNTFITAFFKLFLAIVIVSMMANEYSNKTIKQNLIDGLSKKE
FT                   FILSKFLTVTSFSLISTVFVFVVSMILGLIYSDYNEVSIIFSDLEFLLAFFIKLMGFFS
FT                   FCLFLGILVKRSAFALGFLILWQVFEGFVRGMIRWKLFDGDTTDVVMGFFPLNAMWKLI
FT                   DEPFSRLGAVQSVADQIGEKFEMDYGVHWYEILIVAGWTFVFIYLSYALLKKRDL"
     atgctacgat tactacaaat agaatttatt aaactttgga ataaccgagt aagtaaaata        60
     ttgattattt catatttcgt attactcact tctatagccc tagtggccgc aattaaattt       120
     gatattgggc caattaagtt tcatttggca gaacaaggaa ttttcaattt cccatacatt       180
     tggcatttca acacttttat aaccgcattc tttaaattat tccttgctat tgtcattgtt       240
     tccatgatgg ccaatgaata tagtaataag accataaagc aaaacttgat agacggcctt       300
     tccaagaaag agtttatcct ttcaaagttt ctcacggtca cttcattttc attgatctca       360
     accgtatttg tatttgttgt ttcaatgatt ttagggctta tctattcgga ttataatgaa       420
     gtttcaatca ttttttctga cctggaattc cttttggctt tcttcattaa actaatgggt       480
     ttcttctctt tttgcttatt ccttggcata ctggttaaaa gatctgcatt tgcccttggt       540
     tttttgattt tgtggcaggt attcgaaggt tttgtgcgag gtatgatcag gtggaaactc       600
     tttgatggtg acaccacaga tgttgtaatg ggcttttttc ccctgaatgc aatgtggaaa       660
     ttaattgatg agccattttc aagacttggg gcggttcaat cggttgctga ccagataggt       720
     gaaaaatttg aaatggacta tggcgtacat tggtatgaaa tcttgatcgt tgccggctgg       780
     acgtttgttt tcatctattt atcctatgcc ttgttgaaaa agagggattt atag             834
//

If you have problems or comments...

PBIL Back to PBIL home page