(data stored in ACNUC7421 zone)

EMBL: CP002157.PE443

CP002157.PE443       Location/Qualifiers
FT   CDS_pept        476474..479182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00900"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00900"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00180"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026341"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVF8"
FT                   /protein_id="EAR00180.1"
FT                   /translation="MIKKNAILLIFSIVFPALVFGQGETSNWYFGNNAGIHFNNNGTVT
FT                   ALNDGRLETFEGCTTISNDLGDLLFYTDGIIVYDRNHNVMQNGTGLFGDPSSTQSALIV
FT                   PKPEDPNIYYIFTVDTSTSTNDPDFGLNYSIVDITLNSGNGAITQKNTRLLNDCSEKIA
FT                   AVLKDCSDKTIWIVTLSSQFGSGGFDTYHAFEISASGVSTNVVKSTFSKLSIEDPRGYL
FT                   KFSNDGKKMASANMRFGLHLFDFDPLTGVVSNFQELVINSANNNPYGVEFSPNSRFLYT
FT                   HSSNFVEGEAKHASSLIQFDLDAPNITDSQVAIDYKRIYRGALQLGANGKIYRTIADSY
FT                   DDGTPFLGVINNPNEKGDNANYQHNAIALGNNSTQGLPPFIQSFFNKTDLIFNADGTSS
FT                   GSTTICIGEPFTLQAEEIPGAVYNWEKDGNPIINPDNHLLHIDEAENIDAGRYSLEIIL
FT                   PSQVDCNILGESLIEVLELPQNTDLTLVQCDVDIDNTEDGFTGFNLDQIDENPAFIYSF
FT                   YENIANRDNDIQIENIQNYRNSNPFNQIIYYRVMNTAGCENFGELELQVRTVNLDDENR
FT                   NTLFACDENLNDQVLSATFSLESVTTPIYPNSLVSFYDSLENLALEQEPLPSNIVSESR
FT                   VVYARIENSNQCEDVLEIELVVNPTPLVDLNKTYELCTDDPFLNIYAPLSYDYYNWMKI
FT                   DGASPQILSNTQEIAITEVGGYTLEVGYTYQNNGQVQNCTNSYDFEVIPSNRAVIENIF
FT                   VKDFSNNNSLLVEASGDGDYEFSTNGVEYSDSNFFQNVIPGVITVSIRDKKGCGIVEKT
FT                   VSVMGYPKFFTPNGDTINDKWNLIGLSSEIESNSVVSIFDRYGRLLTVLYATNEGWNGD
FT                   FNTKPVPSGDYWFKAELGDGRIFNGHFALKR"
     atgattaaga aaaatgccat attgctaatt tttagcattg tttttcctgc cctagtattt        60
     ggtcaagggg agacttccaa ttggtatttc ggaaacaatg ctggtattca tttcaataac       120
     aatggtaccg tgaccgcact aaatgatggt aggttagaaa ctttcgaagg ttgtactact       180
     atttcaaatg acttaggtga cttgcttttt tatacagatg gcatcatcgt atatgaccgt       240
     aatcataacg tgatgcagaa cggtaccggt ctttttggag acccatccag tacacaatct       300
     gcattaatcg ttcccaaacc agaggaccct aatatatatt acatttttac cgtggacacc       360
     tccacttcca ccaacgatcc tgattttggg cttaactatt ctatcgtaga tattacattg       420
     aacagcggta atggcgctat aacccaaaaa aatactcgtc tattaaatga ttgctcagaa       480
     aaaattgccg cagtattaaa ggattgttca gataagacca tttggattgt aacccttagc       540
     tcccaattcg gcagtggggg ttttgatacg taccatgctt ttgaaataag cgcctccggg       600
     gtatcaacta atgtggttaa aagtacgttt tccaaattaa gcattgaaga cccaagaggt       660
     tatttaaaat tttccaatga tggaaaaaaa atggctagtg ccaatatgcg ttttgggcta       720
     catctgtttg attttgaccc attgaccggg gttgtttcca actttcagga gctagtaata       780
     aacagtgcaa acaataaccc ttatggcgtt gaattttctc ccaatagtcg ttttttgtat       840
     acccattcct caaattttgt tgaaggagaa gcgaagcatg cttcatcctt gattcagttt       900
     gatttagatg ctccaaatat aacagattcc caagttgcaa ttgattataa gcgaatttac       960
     cgaggtgcct tgcaattggg cgccaacgga aaaatatatc gtacaattgc cgatagttat      1020
     gatgatggaa cccctttttt aggtgtaatc aataatccca atgagaaagg tgacaatgct      1080
     aattaccaac ataatgcaat tgccctgggc aataatagca cgcaaggatt accccctttt      1140
     attcaatctt tctttaacaa aaccgacttg attttcaatg cagatggaac atctagtggt      1200
     tcgacgacca tttgcattgg cgagccattt acattgcagg cagaagaaat accaggtgcc      1260
     gtttacaatt gggaaaaaga tggaaatcca attattaatc ccgataacca tcttttacat      1320
     atcgacgaag cagaaaacat tgatgccggt cgctatagtc tagagattat tcttccaagc      1380
     caagtagatt gtaatattct aggagaatcg ttgatagaag ttttggaact cccccaaaat      1440
     acagatttaa cattagtaca gtgcgatgtt gatattgaca atactgaaga tgggtttacc      1500
     ggttttaatc ttgaccagat agatgagaac cctgcgttta tctattcatt ttatgagaac      1560
     atcgctaata gggataatga tattcaaata gaaaatattc aaaattatag aaactcgaat      1620
     cctttcaacc agataatata ttacagggtg atgaatacag ccggttgtga gaattttggt      1680
     gaattggaac tacaggtcag gactgtgaat ctagatgatg aaaaccgaaa tacattgttc      1740
     gcatgtgatg aaaatttaaa tgatcaagtt ttatctgcta cattcagcct tgaaagcgtc      1800
     acaactccaa tttatccaaa tagtcttgtt agtttttatg attctttgga aaaccttgcc      1860
     ttggaacaag aaccgcttcc aagtaatata gtgtctgaat ctagagtggt ttatgcaaga      1920
     attgaaaact ctaaccaatg tgaggatgtt cttgaaattg agcttgtggt taacccaacg      1980
     ccgttggttg atttgaataa aacatatgaa ctatgtactg atgacccttt tctaaacata      2040
     tatgctcctt tatcatatga ttattacaat tggatgaaaa ttgatggggc tagcccacaa      2100
     atcctttcca atacacaaga gattgctata accgaagttg gtggttacac tctagaggtg      2160
     ggctatacat atcaaaataa cggacaagta cagaactgca ctaattcata tgattttgaa      2220
     gtgattccat caaatcgcgc agttattgaa aacatttttg taaaagactt ttcaaataat      2280
     aactcactac ttgtggaggc ctctggtgat ggagactatg aattctcgac aaatggagtt      2340
     gagtatagtg attccaactt ttttcaaaat gttatcccag gggttataac ggtaagtatc      2400
     agggacaaga aaggatgtgg tattgttgag aaaacagttt cggtaatggg ctatccaaaa      2460
     tttttcaccc caaacgggga cacaatcaat gataaatgga atttaatcgg cttaagctcc      2520
     gaaattgagt caaattcagt cgttagtatt tttgacagat acggacgatt gctaaccgtc      2580
     ttgtatgcca ctaatgaagg atggaatgga gatttcaata caaaacctgt accatcaggt      2640
     gattattggt ttaaagctga actaggagat ggaagaatat tcaatggtca ttttgcttta      2700
     aagcgatga                                                              2709
//

If you have problems or comments...

PBIL Back to PBIL home page