(data stored in ACNUC7421 zone)

EMBL: CP002157.PE450

CP002157.PE450       Location/Qualifiers
FT   CDS_pept        complement(484371..484829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00935"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00935"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00187"
FT                   /db_xref="GOA:A4AVG5"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVG5"
FT                   /protein_id="EAR00187.1"
FT                   /translation="MLIKKVITKVMLNEKNLVTILFLVRLLSNSSINHQSLNKQIMRKL
FT                   SLVFVAAMLLATGNILANDSVKDDPTKKLSTQIGELLGDNYETGDDVSLTAQVRFTLNN
FT                   EGEIVVLSVDTENKRLESFVKGRLNYKKVSVQNASEGTMFTIPIRIAS"
     atgttgatta aaaaagtaat aactaaagtt atgttaaatg agaaaaacct tgtaacgatc        60
     ttgttcctgg tacgtctttt aagtaattca tcaattaatc atcaatcatt aaacaaacaa       120
     atcatgagaa aattaagttt agtatttgta gctgcaatgc tacttgcaac aggaaacatt       180
     ttagctaacg attcagttaa agacgatcca accaaaaaac tatccactca aattggagag       240
     cttttggggg ataattacga gactggtgat gacgtgagct taacggcaca ggttagattt       300
     accttgaaca acgagggtga aattgtagtt ttgtcagttg atactgaaaa taaaagactc       360
     gagtcttttg taaaaggtag attaaactac aaaaaggtaa gtgttcaaaa cgctagtgaa       420
     ggtacaatgt ttactattcc tattagaatt gcaagctag                              459
//

If you have problems or comments...

PBIL Back to PBIL home page