(data stored in ACNUC7421 zone)

EMBL: CP002157.PE452

CP002157.PE452       Location/Qualifiers
FT   CDS_pept        complement(486253..486891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00945"
FT                   /product="ATP-dependent protease La domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00945"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00189"
FT                   /db_xref="GOA:A4AVG7"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVG7"
FT                   /protein_id="EAR00189.1"
FT                   /translation="MQIPLFPLKSIFFPGETVPLHIFEDRYKQLIQDCRNEAITFGIPV
FT                   FIYDQIAYGTEVQLVEIVNTYDSGEMDVVCVGRQVFKILSFENEMNGKLYPGGNVEFLE
FT                   GLNDATDDLKIQVLDGIKELYTLMDVSFTPMALGKFNMYSLIHKIGLSYEQEYQLLQMP
FT                   KESERLEFVSSHLSTTITVLNELDRTKGTIKMNGDFKNFDPLDFEDFKI"
     atgcaaatac ctttatttcc tttaaaatcg atttttttcc ccggtgaaac tgtaccctta        60
     cacatttttg aagatcgtta caagcagctt atccaagatt gtagaaatga ggctattact       120
     ttcggtatcc ctgtatttat atatgaccag attgcctatg gcactgaagt tcaacttgtc       180
     gaaattgtaa atacatatga tagtggtgaa atggatgtgg tatgtgtggg aaggcaggtt       240
     tttaaaatac tatcatttga gaatgaaatg aatggcaagt tgtatccggg aggaaacgta       300
     gagtttttgg aaggattgaa cgatgctact gatgatttga aaatacaggt ccttgatggc       360
     attaaggaat tatatacctt gatggatgtg tcttttactc caatggcttt aggtaaattc       420
     aatatgtata gtctaatcca taaaatagga ctgtcctatg aacaggaata tcaattattg       480
     caaatgccca aggaaagtga gcgattagag tttgtttctt cccatttatc tacgactatt       540
     acggttttga atgagttgga caggaccaag ggtacaatca aaatgaatgg cgatttcaaa       600
     aattttgacc ctcttgattt tgaagacttt aaaatttga                              639
//

If you have problems or comments...

PBIL Back to PBIL home page