(data stored in ACNUC7421 zone)

EMBL: CP002157.PE458

CP002157.PE458       Location/Qualifiers
FT   CDS_pept        complement(491631..492809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_00975"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_00975"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00195"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVH3"
FT                   /protein_id="EAR00195.1"
FT                   /translation="MKNPILLFAVLFTAFLSAQTVTDSIMLNPQKQLNAAQRLLSGNYA
FT                   SAVTIGAYGEMLYNQPEGDNGELDVQRLVLLMGYRFNEKTQFVTEIEFEHVEEVFVEQA
FT                   FVNYNVGNNVNLRGGLMLVPMGIVNEFHEPTTFNGTERPAMDNVIVPTTWRELGVGVSG
FT                   RFDNLSLGYQAYLFNGFKSTLADGEGGVSGVLKGSNGLRSGRQKGIKSTVDSPNLSTKL
FT                   DYYGIPGLRLGLSTYFGKTQAADEVEEIDGANIGISMIGLDARYAYQRFTARGQFIHAS
FT                   LSDTEDYNALTGRDLGSALQGWYVESAFNLLPTKNQQKLFAFARYEKYDTHASTAGSLT
FT                   KNNAYDKTDITTGLTYHLAPGVVLKGDYQFRSNALDNGDVKDRLNFGIGVWF"
     atgaaaaatc caattttatt atttgcagta ttgtttacag catttttatc tgctcaaaca        60
     gttacagatt caataatgtt gaatcctcag aaacaattaa atgccgcaca aagattgtta       120
     tcaggaaatt atgcctcagc tgtcaccatt ggcgcgtatg gtgaaatgct atacaatcag       180
     ccagaagggg acaatggcga attggacgtt caacgattag tgttgttaat gggctatcgt       240
     ttcaatgaaa aaacccaatt cgtaacggaa atcgagtttg aacatgttga ggaagtcttc       300
     gttgagcaag ctttcgttaa ttataatgtt ggtaataatg ttaaccttag aggtggttta       360
     atgttagtgc ccatgggaat cgtaaatgag tttcatgaac ccacaacttt taatggtacg       420
     gagcgaccag ctatggacaa tgttattgta ccaaccacct ggagagaact tggtgtcggt       480
     gtcagtggtc gttttgacaa cctttcatta ggttatcaag catatctgtt caatggtttt       540
     aaatcaactt tggcagacgg ggagggtgga gtttccggtg ttttaaaggg atctaacggc       600
     cttcgaagtg gtcgccaaaa ggggattaaa tcaactgttg atagcccaaa tttatctaca       660
     aaattggatt attatggcat acctggcttg cgcctagggc tttcaactta ttttggtaaa       720
     acacaagcgg cagatgaggt tgaggaaatt gatggtgcca atattggtat atctatgatt       780
     ggtttagatg cccgttatgc ttatcagcga tttactgctc gtggtcagtt catacatgct       840
     tctttgtcag atactgagga ttacaatgcc ttaacgggta gggatttagg tagtgcgcta       900
     caaggttggt atgttgaaag tgcgtttaat cttctgccaa ctaaaaacca acaaaaactg       960
     tttgcatttg cccgttatga aaaatatgat acgcatgctt caaccgctgg atctttaaca      1020
     aagaataatg cctatgataa aacggatatt acaactggtt taacttatca tttggcacct      1080
     ggtgttgttt tgaaaggtga ttaccagttc agaagtaatg cgttggataa tggcgatgtc      1140
     aaagatcggt tgaattttgg tatcggagtt tggttttag                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page