(data stored in ACNUC7421 zone)

EMBL: CP002157.PE465

CP002157.PE465       Location/Qualifiers
FT   CDS_pept        497903..498496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01010"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00202"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="InterPro:IPR016786"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI0"
FT                   /protein_id="EAR00202.1"
FT                   /translation="MEKLEAYYAKERPFKGAINKLRELAAKTNAVETLKWGSPVYVADG
FT                   KNVFWIARFKNHFGLGFFNGVFLKDPKKVLINAQEAKTQAMRHWHFKSIEEINDATVIA
FT                   YMNEAIDNQLKGMRLIPEKKKKTKLVIPKLLQDVFSKNIETKKAFDTLTPYKQKEYAKH
FT                   IISAKQEKTKLSRLEKIIPMINAGLGLNDKYRNC"
     atggaaaaat tggaagctta ctatgccaag gagcgcccct ttaaaggtgc aatcaacaaa        60
     ttaagagaat tggccgcaaa aaccaatgcc gttgaaactt taaaatgggg ctcccccgta       120
     tatgtggcag atggaaaaaa cgtgttttgg atagcaagat tcaaaaatca ttttggattg       180
     ggttttttca atggtgtttt tttaaaagac ccaaaaaagg ttttaatcaa tgcgcaagaa       240
     gctaaaaccc aagcaatgcg tcattggcat tttaagtcga ttgaggaaat aaacgatgca       300
     acggtaattg cttatatgaa cgaagccatt gataatcaat tgaagggcat gcgattaatc       360
     cccgaaaaaa agaaaaagac caaacttgta attcctaaac tcttgcaaga tgtattttcg       420
     aaaaacattg aaacaaaaaa agcatttgac acacttacac cctataaaca aaaagaatat       480
     gccaaacata taatttcggc caaacaagaa aaaaccaaac tttcgcgttt ggaaaaaata       540
     atcccaatga ttaacgctgg acttggtcta aatgacaaat accgtaactg ctga             594
//

If you have problems or comments...

PBIL Back to PBIL home page