(data stored in ACNUC7421 zone)

EMBL: CP002157.PE469

CP002157.PE469       Location/Qualifiers
FT   CDS_pept        complement(500811..501725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01030"
FT                   /product="putative N utilization substance protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01030"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00206"
FT                   /db_xref="GOA:A4AVI4"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI4"
FT                   /protein_id="EAR00206.1"
FT                   /translation="MQCIYALTQSKDESLEKQEKFLKVSIENMYTLYLLMLSLLIEIQQ
FT                   LASNKVELSSKKYLSNSSDSFPDKRKFAKNRLLAKLSDNESLKSELEKRKLKNWYLNEE
FT                   YVKLIYKEIVESDVYAKYMIIPSSTFKDDKEFISTIFKEVIAPNEKIYDYFEDDKLTWV
FT                   DDIPIVNTFILKQLKKVSEDKSDSYFLPRLLKDNEDMDFAQKLLTKTLLNNSKWEKEIE
FT                   GKTPNWDKDRIADIDAILLKMAICELLNFPSIPEKVTINEFLEIAKEYSTPKSSIFING
FT                   ILDKLVKEYKTEGKLKKVGRGLL"
     atgcagtgta tctatgcatt gacccaatca aaagatgaat ctttggaaaa acaggaaaag        60
     ttcctgaaag taagtataga gaacatgtat accctttatt tattgatgct gagcctgttg       120
     attgaaattc aacagttggc cagcaataag gtagaattgt cttccaaaaa atacctctcc       180
     aatagttctg attcttttcc ggacaaaaga aagtttgcta aaaatagatt attggcaaaa       240
     ttgtctgata atgaaagttt gaaatcagaa ttggaaaaaa gaaaattaaa aaattggtat       300
     ttaaatgagg aatacgtaaa actcatatat aaagagatag ttgaaagtga tgtctatgct       360
     aagtatatga ttattccttc gagcacattt aaagatgaca aggagtttat ttcgactatt       420
     tttaaagaag tcattgcccc gaacgaaaaa atatatgact atttcgaaga tgataagcta       480
     acttgggtag atgacatacc tattgttaac accttcatct taaaacagtt aaaaaaggtc       540
     agtgaagata aaagcgattc ctatttcttg ccaagacttt tgaaagataa tgaggatatg       600
     gattttgccc agaaattgtt gaccaaaaca cttttgaaca acagcaaatg ggaaaaagaa       660
     attgagggca aaacacctaa ttgggataag gatcgtatag ctgatataga cgctatatta       720
     ctaaaaatgg caatttgcga acttttgaat tttccgtcta ttccagaaaa ggtgaccatc       780
     aacgaatttc tggaaattgc taaagagtac tcaaccccaa aaagtagtat tttcattaat       840
     ggcatcttgg ataaactggt aaaagagtat aaaaccgaag gaaaacttaa aaaggttggt       900
     cgcgggctat tataa                                                        915
//

If you have problems or comments...

PBIL Back to PBIL home page