(data stored in ACNUC7421 zone)

EMBL: CP002157.PE470

CP002157.PE470       Location/Qualifiers
FT   CDS_pept        501936..503690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01035"
FT                   /product="ABC transporter, ATP-binding protein, MDR family"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01035"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00207"
FT                   /db_xref="GOA:A4AVI5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI5"
FT                   /protein_id="EAR00207.1"
FT                   /translation="MKELKHLNKYFKKYWLKLLVGMIITVAAKIFQLIMPSYANKSITV
FT                   VEDFIKGELTQEVAKEMLLEFILIIIGAALLSGFLTFLMRQTIIYVSRYIEYDLKNEIF
FT                   DHYQFLSLNFYKKNRTGDLMNRISEDVSQVRMYSGPALMYGMNTITLFACIIPIMFIKA
FT                   PTLAAYTLIPLPILSVLIYQISKVIHKRSTVVQEYLSSLSTFTQEVFSGVSVIKAYAIE
FT                   PKINAELSALALEGKNKSMDLAKVNAWFFPLMILLIGISNIFVIYIGGQQYINGEIASV
FT                   GLIIEFIIYVNMLTWPVAIVGWLTSIIQRAEASQKRINEFLKVESEITNEVSEETPIKG
FT                   KIEFKNVSFTYDDTNITALRNISFTIKEGQTVAILGKTGSGKSTILDLIARLYDVGSGQ
FT                   ILVDGESLKKLNLNTLRKSIGAVPQDAFLFSDTIKNNIKFGDYDSSDEEVIQVAKNAVV
FT                   HKNIMDFKNQYDTVLGERGITLSGGQKQRVSIARALLKNPQIYLFDDCLSAVDTETEET
FT                   ILNNLQKASSAKTTIIVSHRVSSAKNADKILVLEDGRLLQEGTHEKLNNVEGYYKELYM
FT                   HQLAEKEN"
     atgaaagaac tcaaacatct taataaatat ttcaaaaaat attggctaaa actcctggtt        60
     gggatgataa ttacggtagc ggccaaaatt tttcaattga taatgccgtc ctatgccaat       120
     aaatcaatta ctgttgtaga ggattttatc aaaggtgaat tgacacaaga ggtcgctaaa       180
     gagatgctac tggagtttat tcttataatt attggtgctg cgttgctttc tggttttttg       240
     acattcttga tgcgccagac tattatttat gtttctcgat atatagaata tgatttaaaa       300
     aatgaaattt ttgatcatta tcaatttcta agtttaaatt tttataaaaa gaatagaact       360
     ggggatttga tgaaccgtat tagtgaggat gttagccaag tgcgcatgta ttcaggaccg       420
     gctttgatgt atggtatgaa taccataaca ttgttcgcat gtattattcc cattatgttt       480
     atcaaggcac caacgctagc agcttatacc ttgattccac tcccaatcct atctgtactt       540
     atttatcaaa taagtaaagt catacataag cgaagtacag tggttcaaga gtatctttct       600
     tcactctcaa cttttacaca ggaggttttt tcaggggttt cggtaattaa agcatatgca       660
     attgagccca aaataaatgc agaattaagt gctttggcgt tagagggcaa aaacaaaagt       720
     atggacctag caaaagttaa tgcctggttt tttccgttaa tgattttact tattggtata       780
     agtaacattt ttgtaatata tataggagga caacagtata taaatggaga aattgcatct       840
     gtaggcctta ttatagagtt cattatttat gtgaatatgt tgacatggcc tgtggcaata       900
     gtaggttggc ttacctcaat tatccaaaga gctgaagcat cacaaaaaag aatcaatgaa       960
     tttttaaaag tagaatctga aattacgaat gaggtttcag aagaaacacc tataaaagga      1020
     aaaatagaat tcaaaaacgt aagttttact tacgatgaca ccaacataac cgcgttaaga      1080
     aatatttcat tcactattaa agagggccaa acagttgcga ttttgggcaa aacaggctcg      1140
     ggaaagtcaa ctattctgga tttaatcgca agactttatg atgttggttc tggccaaata      1200
     ttagtggatg gtgagtcttt aaaaaaatta aatctcaata ccctgcgtaa atctataggc      1260
     gcagtaccgc aagatgcttt cttattctcg gacacgatta agaacaatat caaatttggt      1320
     gattacgact catcggatga ggaagtaatc caggtggcaa aaaatgccgt tgtccacaaa      1380
     aatatcatgg atttcaaaaa tcagtatgac acagttcttg gagagcgtgg cataacatta      1440
     agcggtgggc aaaaacaaag agtatccatt gctcgagcgc tattgaaaaa tccgcaaata      1500
     tatttattcg atgattgcct ctcggcggtc gacacagaga ctgaagagac cattttaaac      1560
     aaccttcaaa aggcgtcaag tgccaaaacg accatcattg tgagtcatcg agtatcatca      1620
     gcgaaaaacg cagataagat cttggtactg gaggatggaa ggttactgca ggaaggaacc      1680
     catgaaaaat tgaacaatgt agaaggatat tacaaggaac tctatatgca tcaactagcg      1740
     gaaaaagaaa actag                                                       1755
//

If you have problems or comments...

PBIL Back to PBIL home page