(data stored in ACNUC7421 zone)

EMBL: CP002157.PE471

CP002157.PE471       Location/Qualifiers
FT   CDS_pept        503769..504140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01040"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01040"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00208"
FT                   /db_xref="GOA:A4AVI6"
FT                   /db_xref="InterPro:IPR006628"
FT                   /db_xref="InterPro:IPR021694"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI6"
FT                   /protein_id="EAR00208.1"
FT                   /translation="MRDKDLIDQEEIHSKVLRAGRRTYFFDVRSTKAGDYYLTITESKK
FT                   FTHDDGSFHYKKHKIYLYKEDFTAFRENVEEMMDFIIDEKGSEVISERHQKDFKKEEHQ
FT                   ENGEMKATESFTDVDFDDI"
     atgcgcgaca aagatttaat agatcaagaa gaaatacact ccaaggtttt aagagccggg        60
     agaagaacat atttttttga tgtaagaagt accaaagcgg gagattatta ccttacgatt       120
     accgagagta agaaatttac acatgatgac gggtcgtttc attataaaaa gcacaagatt       180
     tatctctata aagaagactt taccgccttt agggaaaatg tggaggaaat gatggatttc       240
     atcattgatg aaaaaggaag tgaagtaatc tcagaaagac atcaaaaaga ttttaaaaaa       300
     gaagaacatc aggagaatgg tgagatgaaa gctaccgaaa gtttcacaga tgtagatttt       360
     gatgatattt aa                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page