(data stored in ACNUC7421 zone)

EMBL: CP002157.PE472

CP002157.PE472       Location/Qualifiers
FT   CDS_pept        504224..506746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01045"
FT                   /product="Secreted protein containing N-terminal
FT                   zinc-dependent carboxypeptidase related domain"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01045"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00209"
FT                   /db_xref="GOA:A4AVI7"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033848"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI7"
FT                   /protein_id="EAR00209.1"
FT                   /translation="MKSILLTLALLISCSVAAQENLDLNYYLPQNVTYNTNIPTPKEVI
FT                   GHEVGEWHVTHDKLMFYMQTLAQKSDRITIETRGKTFEGRPILLLTVTSPSNHLNIEKI
FT                   RQDHIALTENGASSLPTNSMPIVVYQGFSIHGNEPSGANAGLAYAYYLAAAQGPEIDNL
FT                   LNNMVILMDPSFNPDGLQRFAYWANTNKSINLVADNNEREYHEVWPGGRTNHYWFDMNR
FT                   DWLPVQLPESRARIKSFHKWLPNILTDHHEMGTNSTFFFQPGEPTRVHPLTPKMNQELT
FT                   AEIGKYHAKALDKIGSLYYSEENYDDYYYGKGSTFPDVNGSIGILFEQGSSRGHIQETE
FT                   NGLLTFPFTIRNQFTTALSTIEAAKNMREKILNYQRDFYKNVRAEAAKSRTKSIVFGDN
FT                   KDGAKAWHLAEILKRQKIKFNELANDVAIGGKKYKKGNSYVVPMNQKNHRLIKAMFEKR
FT                   TTFSDSLFYDISAWTFPLAFNVDYSEQSSMTNAGAEITNFEPLSGNVSGKSSYAYLFEW
FT                   NEYYTPKALNKIVEKGLRAKVAKSPFSLEGKQYDYGTIMVPVQNQELNADDLYTFLKDV
FT                   ANESMLKIISVGTGLTKGIDLGSNDFDPIKKQKVAILVGNGIRSYDAGEIWHLFDTRYN
FT                   MQLTKLDVAYLSNVDLNKYTDLIIPSSWGGGLSKKYAEKIKEWVKEGGTLIGYRSVAEW
FT                   LNKNEVIKLKFKKDTLVAKNISFAEKGDFNGAQVTGGAIFEAKLDLSHPINYGYKNDRL
FT                   AMFRNSNVYIEADKNSYNNPIQYTNSPLLSGYISEENLELLKNSVPFQVKRVGKGRVIV
FT                   FTDNTNFRAFWYGTNKLLMNAIFFGKMM"
     atgaaaagta tactcctaac gctagctctt ttgatttcct gctccgttgc tgcgcaagaa        60
     aatcttgacc ttaactatta tcttcctcaa aacgttactt ataacacaaa cattccgaca       120
     cctaaagagg taataggaca tgaagttggt gagtggcatg ttacacatga caaactcatg       180
     ttttatatgc agaccctcgc tcaaaaaagt gatcggataa ccattgagac aagaggtaag       240
     accttcgagg gcagaccaat attgttgcta actgtgacat caccatcaaa tcatttgaat       300
     attgagaaaa taaggcagga ccatattgca ctaactgaaa atggggccag ttctttacca       360
     acaaactcaa tgcccattgt tgtttaccaa gggttttcta tccatggtaa tgagcctagt       420
     ggtgccaatg cgggattggc atacgcctat tatttggcag ctgcccaagg tccagaaata       480
     gataaccttt taaacaacat ggttatttta atggatcctt ccttcaatcc tgatggttta       540
     caacgttttg cctattgggc aaatacaaac aaaagcatca accttgtggc cgacaataat       600
     gaaagggaat atcatgaggt ctggccaggt ggtcgtacca atcattattg gtttgacatg       660
     aatcgtgact ggttgccagt acaattgcca gagagcaggg ctagaataaa gagttttcat       720
     aagtggttgc ctaatatatt aaccgaccat catgaaatgg gaactaattc aactttcttt       780
     tttcagccag gtgagccaac aagagtacac cccttgaccc caaaaatgaa ccaagagttg       840
     actgcagaga ttggaaagta ccatgcaaaa gcgctggaca aaattgggtc attatactat       900
     tctgaagaaa actatgatga ctattactat ggaaagggtt ctacctttcc agatgttaat       960
     ggtagtatcg gtattttatt tgagcaagga agctccagag ggcatattca agaaactgaa      1020
     aatgggcttt tgacattccc tttcacaata cgcaatcagt ttaccacagc tttgtctaca      1080
     attgaagctg ccaagaatat gcgtgaaaaa atcttgaact atcagcgcga tttttacaaa      1140
     aatgtaagag ctgaagctgc taagagcaga acaaaatcga ttgtttttgg agataataaa      1200
     gatggagcca aagcctggca tttagccgaa attctaaaaa gacagaaaat aaaattcaac      1260
     gaattggcga acgatgtcgc aattggagga aaaaagtata agaaaggtaa tagttacgtg      1320
     gttccaatga atcaaaagaa ccaccgactt attaaagcca tgttcgaaaa aagaactaca      1380
     ttttcggaca gtctttttta tgatatttca gcttggactt ttcctttagc attcaacgtt      1440
     gattattctg aacaaagttc tatgacaaat gctggagctg aaattaccaa ttttgagcca      1500
     ttgtccggta atgtaagcgg aaaaagcagt tatgcatatt tgtttgaatg gaatgaatat      1560
     tataccccta aagctttgaa caaaatagta gaaaaaggtt taagggccaa agtggccaaa      1620
     tcacctttta gtttggaggg caaacaatat gattacggta caataatggt cccggttcag      1680
     aatcaagagt tgaatgctga cgatttgtac acttttctaa aagatgtagc caatgaaagt      1740
     atgcttaaga taatatctgt tggtactgga cttaccaagg gtattgattt gggtagtaat      1800
     gattttgatc ctattaaaaa acaaaaggtt gccatacttg tcggtaacgg aataagatca      1860
     tatgacgcag gtgaaatttg gcatttgttt gatacacgtt acaacatgca gttaaccaaa      1920
     cttgatgtgg cctatttaag taatgtggat ttaaacaaat atacagattt gattattcct      1980
     agctcatggg gaggtggact atcaaaaaag tatgccgaaa agataaaaga atgggttaaa      2040
     gaaggtggca cattgattgg gtatagaagt gttgctgagt ggcttaataa gaacgaagtt      2100
     attaagttga agttcaaaaa agatacttta gttgctaaaa acatatcctt tgctgaaaaa      2160
     ggagatttta atggtgctca agtaactggt ggcgccattt ttgaagctaa actagatctt      2220
     tcacatccca taaattatgg ctacaagaat gatagacttg ccatgttcag gaactcaaat      2280
     gtttatattg aagctgataa gaacagttat aacaatccta ttcagtatac caatagtcct      2340
     ttgttgagcg gatatatttc agaggaaaat ttggagctct tgaaaaattc agtgcccttt      2400
     caagtaaaga gagttgggaa aggaagggtc atcgtattta ctgacaatac taatttcaga      2460
     gctttttggt atgggacaaa caaattatta atgaatgcca tattttttgg taagatgatg      2520
     taa                                                                    2523
//

If you have problems or comments...

PBIL Back to PBIL home page