(data stored in ACNUC7421 zone)

EMBL: CP002157.PE473

CP002157.PE473       Location/Qualifiers
FT   CDS_pept        complement(506748..507791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01050"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00210"
FT                   /db_xref="GOA:A4AVI8"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI8"
FT                   /protein_id="EAR00210.1"
FT                   /translation="MKIGYNIVKLWLRTGLFFYYTKMEVVGRENIPKGKPIMLLANHQN
FT                   ALMDPLMIAMNCGMNPYFLARSDLFKKPLVSKFLHYLQMMPIYRFRDGVDTLKNNPAIF
FT                   KKCGDLLVNGETVMLFPEGNHGILRRVRWPMRKGFVKMIFCALEKEPNLDIRILPVGLN
FT                   YLKAEGFPDSVSMHIGKDFAVQDCFDPDDLVATEAKLKDEIYDRLQKVTTHISDEKTYE
FT                   NVLTQLKNQKVDYLNPNSVNGIISGIDPNIKVTPIKRNTNWISGFMKILFSIINFPILL
FT                   LWNKRIKSIPLDIEFRTTLRFMMSLILFPVYYLLLYLLLRYTLGQEIALTIISAQVLFN
FT                   LLYVKLK"
     atgaaaatag gatataacat tgtaaaactc tggcttagaa caggtctgtt tttctattat        60
     actaaaatgg aggttgttgg cagggagaat attccaaaag gcaagccgat tatgttattg       120
     gcaaatcatc aaaatgcatt aatggatccc ttgatgattg caatgaattg tggaatgaat       180
     ccttattttc ttgcacgatc ggatttattc aagaaaccgt tggtgagcaa atttttgcat       240
     tatttgcaaa tgatgcctat ttatagattc agggatggcg ttgatacttt gaagaacaac       300
     cccgcgattt ttaagaaatg tggagactta ttggtaaatg gtgaaaccgt aatgcttttc       360
     cctgagggca accacggtat tttaagaagg gtaaggtggc ctatgcgaaa aggtttcgtt       420
     aaaatgattt tctgtgcttt ggaaaaggaa cctaatttgg atatccgcat tctacctgtt       480
     ggattaaact atttgaaagc tgaagggttt cctgatagtg tttctatgca tataggtaaa       540
     gattttgcgg ttcaagattg ttttgaccca gatgatttag ttgctaccga agctaaatta       600
     aaagacgaaa tctatgatag actgcaaaag gttacaactc atatttcgga tgagaaaacc       660
     tatgaaaatg ttttaactca attaaaaaat caaaaagtcg attatttaaa tcctaatagt       720
     gtaaatggta ttatttctgg tattgaccca aatattaaag taacgccaat caaaagaaac       780
     acgaattgga tctctggttt tatgaaaata ttgttcagta ttataaattt tcctattctg       840
     cttctttgga ataaaagaat aaaatcaatc ccattggata ttgagttcag gacaactttg       900
     cgttttatga tgagcttaat actcttcccc gtgtattatt tgttacttta tttactgctc       960
     cgatatacat tgggccaaga aatagctcta accattatct cagcccaagt tttatttaat      1020
     cttttatacg ttaagctaaa gtag                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page