(data stored in ACNUC7421 zone)

EMBL: CP002157.PE474

CP002157.PE474       Location/Qualifiers
FT   CDS_pept        complement(507788..508711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01055"
FT                   /product="bile acid transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01055"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00211"
FT                   /db_xref="GOA:A4AVI9"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVI9"
FT                   /protein_id="EAR00211.1"
FT                   /translation="MTETILDNVHINFNSQALWVMNIALALVMFGIALEISVNDFKRLF
FT                   KNPKPIFTGAFSQFLLLPAITFLLVWLIEPIPSIALGMFMVAACPGGNISNFITHLAKG
FT                   NSALSVSLTAVATLLAVFMTPLNLQLWGSMYGPTATILKDVAISPLEMIKLVSLLLAFP
FT                   LVLGMWVNHARPILAKKMAKILKLLSLLFFISLIFLALYNNREIFLDYIFYVFWIVIIH
FT                   NLVAFATGFSIAKIGGLSKKDVRSITIETGIQNSGLGLLLIFTFFEGLGGMALLAAFWG
FT                   IWHLISGLILSAVWGYRPVKKEELVS"
     ttgaccgaaa ccatacttga caatgttcat attaatttca atagccaggc gctgtgggta        60
     atgaatattg ctttggcttt ggtaatgttt ggtattgcct tggagatttc agtgaatgat       120
     tttaagcggt tatttaaaaa ccctaaacct attttcactg gagctttcag tcagtttctt       180
     ttgctcccag cgattacctt cttacttgtt tggttaatcg agcctattcc tagcattgct       240
     ttggggatgt ttatggttgc tgcttgccca ggaggaaata tttcgaattt tataacacat       300
     ttggccaaag ggaattcagc tttatctgta agtctgaccg cagtggcgac cttattggca       360
     gtttttatga cacctttgaa tttacagttg tggggatcga tgtatggtcc aactgccaca       420
     attttaaaag atgttgccat atcaccttta gaaatgatta aactggtctc tttgttgctg       480
     gcatttccac tggttttggg aatgtgggtt aatcatgcta gaccaattct agcaaaaaaa       540
     atggctaaaa ttttaaaact tctttcgctg ttgttcttca tttctttgat tttccttgct       600
     ctttataaca atcgagagat ttttttggat tatatatttt atgtgttttg gattgtcatt       660
     attcataatc tagtggcttt cgcaacaggt ttttcaattg cgaaaatcgg gggtctttcg       720
     aaaaaggatg tacgttcaat taccattgag accggaatcc aaaattcagg cttaggttta       780
     ttgttgatat ttactttttt tgagggactg ggcgggatgg ctctccttgc ggctttctgg       840
     ggaatttggc atttaatctc tgggttgatt ctttcggccg tatggggtta taggcccgtt       900
     aagaaagaag aattggtgtc atga                                              924
//

If you have problems or comments...

PBIL Back to PBIL home page