(data stored in ACNUC7421 zone)

EMBL: CP002157.PE476

CP002157.PE476       Location/Qualifiers
FT   CDS_pept        509162..509722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01065"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00213"
FT                   /db_xref="GOA:A4AVJ1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVJ1"
FT                   /protein_id="EAR00213.1"
FT                   /translation="MANTPSNMLPLGTKAPAFDLMDTVSGKILSLSSLKGEKGTVIMFI
FT                   CNHCPFVIHINPEISKMAKTYQEVGISFVAISSNDVVNYPQDAPHLMKQTAITEGYIFP
FT                   YLYDESQEVAISYEAACTPDIYLFDDNLNLFYRGQLDDSRPGNGLPVTGKDLRSAIEAL
FT                   IHGKEANTIQKPSIGCNIKWFKK"
     atggcaaata cccccagtaa tatgctgcct ttaggcacaa aagcacctgc gtttgattta        60
     atggataccg tgtctggaaa aattctttcg ttgagttcat taaaagggga aaaaggaact       120
     gtcatcatgt tcatttgcaa tcattgtccc tttgtaatcc atattaatcc tgaaatatcg       180
     aaaatggcaa aaacctatca ggaagttggg atttcgttcg ttgctatatc aagtaatgat       240
     gtcgtgaatt acccccagga tgctcctcac ttgatgaaac aaacggcaat tacggaaggg       300
     tatattttcc cttatctcta cgatgagtcc caagaagtag caatttccta tgaagcagcc       360
     tgtacgccag acatctacct gttcgatgat aatttgaacc ttttttatag ggggcaattg       420
     gatgattcgc gaccaggaaa cggcttacca gttactggaa aagatttaag aagtgcaatt       480
     gaagccctta ttcatggtaa agaagccaat accatacaaa aacctagtat tggctgcaat       540
     ataaaatggt ttaaaaagta g                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page