(data stored in ACNUC7421 zone)

EMBL: CP002157.PE483

CP002157.PE483       Location/Qualifiers
FT   CDS_pept        complement(512905..514305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01100"
FT                   /product="peptidase, M28D family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01100"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00220"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVJ8"
FT                   /protein_id="EAR00220.1"
FT                   /translation="MRFIKLTLIVLLTVWNGFSQSEDEKQIKAIYDAALTKGKAYDWLN
FT                   HLSNQIGGRLSGSVQAQQAVDYTKTQLDSLGVDRVWLQSVMVPKWVRGTPEFAYFETAP
FT                   GITSDVPICALGGSVATPLGGLKANIIEVNGIEQLAKLGKDKIAGKIVFYNKPMDPTLI
FT                   STFQSYSGCVDQRYAGASEAAKFGAVGVIVRSMNLRLDDLPHTGSMSYGDTDASKRIPA
FT                   AAISTNGAELLSTTLKLSPITKFYFKQNCKQFEDVESFNVIGEIQGSKYPNEIMIVGGH
FT                   LDSWDLGDGSHDDGAGCVQSMDVLRLLKESGYRPQRTIRVVLFMNEENGLRGGNKYAEV
FT                   AKDKNENHVFALESDAGGFTPRGFSFDCSDSNFEQVQSWKKLFEPYLIHMFVRGGSGAD
FT                   IGPLKNDEMVLAGLRPDSQRYFDHHHAENDTFEHVNKRELELGAATMTSLIYLFDKYGI
FT                   VKPPKIKG"
     atgaggttta taaagcttac cctgattgtc ttacttactg tttggaacgg attttctcaa        60
     tccgaggatg aaaaacaaat caaagcaata tatgatgctg ctcttacgaa aggcaaagca       120
     tatgattggc ttaaccattt gtcaaatcaa attggaggta gactatctgg ttctgttcaa       180
     gcacagcagg ctgtcgatta tacgaaaacg caattagatt cattgggggt tgatcgtgtt       240
     tggttacagt cggtcatggt acctaaatgg gtacgaggaa ctccggaatt tgcatatttt       300
     gagactgccc caggaataac aagtgatgtt cccatctgtg ctttaggtgg atcagtagca       360
     acacctttag gaggtttaaa ggccaatatt attgaagtaa acggtataga acaattagca       420
     aaacttggaa aagataaaat tgctggtaaa attgtttttt ataataagcc gatggaccct       480
     actcttataa gtacttttca atcgtattca ggttgtgtgg atcagaggta tgctggtgct       540
     agtgaggctg ctaagtttgg tgcggttggt gtgattgtgc ggtctatgaa cttaagattg       600
     gatgatttgc cccatacagg atctatgagt tatggagata cggatgcttc aaaacgtatt       660
     cccgctgcag cgataagtac caatggtgca gaacttttga gtacaacatt gaagttgagc       720
     ccaattacta aattctattt taagcagaac tgtaagcaat ttgaagatgt tgaatctttc       780
     aatgtaatag gggaaataca aggaagtaaa tacccgaatg agattatgat tgttggtggg       840
     cacttagatt cgtgggattt aggtgacggt tcacatgacg atggtgcagg ctgtgttcag       900
     agtatggatg tgttgaggct tttgaaggaa agtggatatc gacctcaaag aactattagg       960
     gttgttttat ttatgaatga agaaaatgga cttcgaggcg gtaataagta tgctgaggtc      1020
     gcaaaggata aaaatgaaaa tcatgttttt gcactcgaaa gcgacgctgg tggatttact      1080
     ccgcgaggct tttcttttga ttgctccgat tctaattttg aacaagtaca aagttggaaa      1140
     aagttatttg agccttatct tattcatatg ttcgttagag gaggaagtgg agccgatata      1200
     ggacctctca aaaatgatga aatggtttta gcagggctaa ggcctgattc ccaaagatat      1260
     tttgatcacc accatgctga aaatgatacg ttcgagcatg ttaacaaaag agagttggaa      1320
     ctaggagcgg caacaatgac gagtcttatt tatctgtttg ataaatatgg tattgtaaaa      1380
     ccacccaaaa ttaaaggata a                                                1401
//

If you have problems or comments...

PBIL Back to PBIL home page