(data stored in ACNUC7421 zone)

EMBL: CP002157.PE487

CP002157.PE487       Location/Qualifiers
FT   CDS_pept        complement(517248..518141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01120"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00224"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVK2"
FT                   /protein_id="EAR00224.1"
FT                   /translation="MKITILLKKSIKSIGYILAVCCFQLGNAQSPDIFRLEYMLMPQNK
FT                   AEAELSRFKLVANAPIKVRETDNIILGAEYNYLAYKIGDQAPFDVQGIKNLHVVDFNLA
FT                   YVYKHNEDWRFIGVATPRLSSTLTNSLENGDVSVNVTVGAFKDKQNIEKPMRLVMGIAY
FT                   NSTVALRIPLPIIYFEKKFHPKWTYVIGVPKTGLKHHLKKNHMIQAEFILDGYFVNLQN
FT                   NIILPNTGFASSISSSAALFTMGYQYNISKNMSFYGYVGHTLFQDGVLRDNDRNDIFTL
FT                   NDEPSLYFRTGFRIGI"
     atgaaaatta caatattgct taaaaaaagt ataaagtcaa tcggttatat tttggcggtt        60
     tgttgctttc aacttggaaa cgcacaatca ccggatattt ttagattgga atatatgttg       120
     atgccacaaa ataaggccga agcagaactc tctcggttta aattggtggc aaatgcccca       180
     atcaaagttc gagaaactga taatattatt cttggagccg agtataatta tttggcctat       240
     aaaataggtg accaagcccc ttttgatgtc caggggataa aaaatcttca tgtcgtggac       300
     tttaatcttg cctatgttta taagcacaac gaggattggc gttttatagg tgtagctact       360
     ccaagattgt cgtctacctt gaccaatagc cttgagaatg gtgatgtatc agtgaacgtt       420
     acggttggtg cttttaagga caaacagaat attgaaaaac caatgcgttt ggtaatggga       480
     attgcttaca attctactgt ggctcttaga ataccattac ctatcatata tttcgaaaaa       540
     aaattccacc ccaaatggac atatgtgatc ggtgtaccca aaacaggttt gaaacatcat       600
     ttgaaaaaaa atcatatgat tcaggccgaa tttatcctgg acggatattt cgttaatctt       660
     caaaataaca tcattctccc aaatacaggc tttgcatctt ctatctcatc atcagcggca       720
     ttatttacaa tggggtatca atataacata tccaaaaata tgtcgttcta cggttatgtt       780
     gggcacacct tatttcaaga tggcgtgtta cgggataacg atagaaatga tatttttaca       840
     ttgaatgatg agcctagttt gtattttagg actgggttta gaataggaat ataa             894
//

If you have problems or comments...

PBIL Back to PBIL home page