(data stored in ACNUC7421 zone)

EMBL: CP002157.PE489

CP002157.PE489       Location/Qualifiers
FT   CDS_pept        complement(519520..520455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01130"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01130"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00226"
FT                   /db_xref="GOA:A4AVK4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVK4"
FT                   /protein_id="EAR00226.1"
FT                   /translation="MNNILVTKEVTKQFGKHIALNKVSLEIPENSIYGLLGPNGAGKTT
FT                   LIRIINQITHPDSGEVYFDGELLKPKHISVIGYLPEERGLYKSMKVGEQALYLAQLKGL
FT                   SKSEAKKRLKYWFEKLDIGDWWNKKVQELSKGMAQKIQFIVTVLHEPKLLIFDEPFSGF
FT                   DPINANIIKDEILNLKENGTSIIFSTHRMESVEELCEYIALIHQSEKILDGKLSNIKKE
FT                   YKNNIYNVGLEVKNPDALLRELSGKFDLTASEINPLENQLDFTVQLPTNDSGEMLTFLA
FT                   NKANVNQFVETIPSANEIFIQTVQSKDANE"
     atgaacaaca ttttggttac taaagaggtt accaaacaat tcgggaaaca tattgctctt        60
     aacaaagttt ccttggaaat tcctgagaac agtatttatg gcctgcttgg tcctaatggt       120
     gctggtaaaa caacattaat acggattatc aaccagatta cccatccaga ttcgggagag       180
     gtgtattttg atggtgaatt gttgaagcct aagcatattt ctgtaatagg ctatttaccg       240
     gaagaaagag gattgtacaa gagtatgaaa gtaggcgaac aagccttgta tttggcccag       300
     ttaaaagggt tgagtaaatc tgaggctaaa aaacggttga aatattggtt cgaaaaactg       360
     gatatagggg attggtggaa caagaaagtt caagaactat ccaaaggtat ggcccaaaag       420
     attcaattta ttgttaccgt tctccatgaa cctaaattgc tcattttcga tgagcctttt       480
     agtggctttg atcccataaa tgcaaacatt attaaggacg aaatcctgaa tttaaaagaa       540
     aacggtacgt ccatcatctt ttcgactcat cgaatggaat cggttgaaga gctctgtgaa       600
     tatatagcac tgattcatca gtctgagaaa attcttgacg gaaaactatc caatattaaa       660
     aaggaatata aaaacaacat ctacaatgtt gggcttgagg taaaaaaccc agacgcctta       720
     ttaagggagc tgtcaggtaa atttgatttg actgcttctg aaattaatcc actggaaaac       780
     caattggatt tcactgtgca gttaccaacc aatgattcag gtgaaatgtt gacatttttg       840
     gccaacaagg ccaatgtgaa ccaatttgtt gagaccattc cttctgccaa cgagatattt       900
     attcaaactg ttcaaagtaa agatgcaaat gaataa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page