(data stored in ACNUC7421 zone)

EMBL: CP002157.PE493

CP002157.PE493       Location/Qualifiers
FT   CDS_pept        complement(523556..524218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01150"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01150"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00230"
FT                   /db_xref="GOA:A4AVK8"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVK8"
FT                   /protein_id="EAR00230.1"
FT                   /translation="MQREIITTADGSKTIQIKDWNEQYHSKHGAIQEAYHVFIKHGLNL
FT                   FKNQDLHILEIGFGTGLNAFITFLEASKLGLKINYRGIEAYPVSQEELSLLNYVSELKA
FT                   QDYNDAFKQMHETDWEKNVSISKTFELHKEQCDFKQVKYQHSYDLVYFDAFGARVQPEL
FT                   WTEEVFEIMFIALKKGGILVTYAAKGSVRRAMQAVGFEVERLPGPPGKREMLRATKP"
     atgcaacggg aaataataac tacggcagat ggctcaaaaa ccatccaaat aaaggattgg        60
     aatgagcaat accactcaaa acatggtgct attcaagagg cttaccatgt ttttattaaa       120
     cacggattaa acttattcaa aaaccaggac ctccatattt tagaaatagg ttttggaacc       180
     gggctgaacg ctttcatcac ttttctggaa gcttccaaat tgggcctgaa aattaattat       240
     agaggtattg aggcgtaccc tgtatcgcaa gaagaacttt ctctattgaa ttatgtttcc       300
     gaattaaaag cacaagatta taatgatgct tttaaacaga tgcacgaaac ggattgggaa       360
     aaaaatgttt caatttcaaa aacctttgag cttcataaag agcaatgtga ttttaagcaa       420
     gtaaaatatc aacacagcta cgatttagtt tattttgatg catttggtgc ccgggtgcaa       480
     ccagaattgt ggaccgaaga agtttttgaa atcatgttca tagcactaaa aaaaggcggt       540
     attttggtta catatgcagc caagggaagt gttagaaggg ccatgcaagc ggttggtttt       600
     gaggttgaga ggttacctgg acctcccgga aaacgtgaaa tgctgagagc gacgaaacca       660
     taa                                                                     663
//

If you have problems or comments...

PBIL Back to PBIL home page