(data stored in ACNUC7421 zone)

EMBL: CP002157.PE494

CP002157.PE494       Location/Qualifiers
FT   CDS_pept        complement(524218..524760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01155"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01155"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00231"
FT                   /db_xref="InterPro:IPR032577"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVK9"
FT                   /protein_id="EAR00231.1"
FT                   /translation="MSIFTIDLENLGIMKGFNILVVLLLLIFSCKGQETKQEVAENPEN
FT                   MGQLVSFGEKILDDGSISNLEMMKKYGEMVVADTVQVKFSGVVKDVCQAKGCWMKVELE
FT                   GGEEAMVKFKDYGFFMPKDIAGKEVIVNGYAFVEEMSVEDQKHYAEDGGKSAEEIAKIT
FT                   EPKKTFGFEADGVLLKE"
     atgtccattt ttacaataga tttagaaaat ttaggaatta tgaaaggttt taacatttta        60
     gttgtgctat tgttattgat tttttcatgc aaaggtcagg aaaccaagca ggaagttgct       120
     gaaaacccag agaatatggg tcagttggta tcgtttgggg agaaaatttt ggatgatggt       180
     agtatttcca acctcgaaat gatgaaaaag tatggagaaa tggtagttgc cgatactgta       240
     caagttaaat ttagtggtgt tgttaaagat gtatgccagg cgaagggttg ttggatgaaa       300
     gttgagttgg aaggtggtga ggaggctatg gttaagttta aagattatgg tttttttatg       360
     cccaaagaca ttgctgggaa agaagtaatt gtaaacggtt atgcatttgt tgaggaaatg       420
     agtgttgagg accaaaagca ctacgccgaa gatggcggta aatctgcaga ggaaattgcc       480
     aaaataacag agccgaaaaa aacttttggt tttgaagcag acggagtgct tttaaaagag       540
     taa                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page