(data stored in ACNUC7421 zone)

EMBL: CP002157.PE495

CP002157.PE495       Location/Qualifiers
FT   CDS_pept        525052..525891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01167"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01167"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99941"
FT                   /db_xref="GOA:A4AVL1"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVL1"
FT                   /protein_id="EAQ99941.1"
FT                   /translation="MKAYKDEKDIVWLFRPLDNCKRLNVSAKRMAIPELPEDYFMDGLV
FT                   ELLNLEKDWIPQSAGSSLYIRPFIFASGNGFHASPADEYTFIIACAPSGAYFSGKVKVL
FT                   IEEKYSRSANGGVGYAKAGGNYAGQFYPTQLAVEKGYNQVIWTDDNTHEYIEEAGAMNI
FT                   FVRINDTLITGPTSDRILDGITRKSILKIAKDEGIPFQVRKITVIEVVEAAKDGSLKEM
FT                   FGAGTAAVISPISTFGYRDTDYDLPEMPEGYATRLKKRITDIQYNRSEDKFGWRYKV"
     atgaaggctt ataaggacga aaaggacatt gtttggcttt ttcgcccttt ggataattgc        60
     aagagattga acgtttctgc gaaacgaatg gctattcctg aattacctga agactatttc       120
     atggacggtc tggttgaact tttgaacttg gaaaaagatt ggattccgca gagtgctgga       180
     agttcattat atattagacc atttattttt gcttcaggaa atgggtttca tgcatcccca       240
     gcagatgaat acacttttat aattgcttgt gcaccatcgg gagcctattt ttctggaaag       300
     gtcaaagtat tgattgaaga aaaatattca agatccgcca atggcggcgt agggtatgcc       360
     aaagccggtg gtaattatgc aggacagttt tacccaacac aactggcagt tgaaaaagga       420
     tacaaccaag tcatttggac tgatgacaac acccatgaat atatagagga agcaggtgcg       480
     atgaatatat tcgtaagaat aaatgacaca ttgatcaccg ggccgacaag tgatagaata       540
     cttgatggca tcacccgaaa gagtattttg aaaatagcca aggacgaagg tattcctttt       600
     caagttcgta aaataacagt aatagaggtt gtagaagctg caaaagacgg atcattgaaa       660
     gaaatgttcg gtgcaggaac cgctgctgtg atctcaccaa taagtacatt tggttatagg       720
     gatacggatt atgacttacc agaaatgccg gaaggatatg caactagact taagaaaaga       780
     ataacggata ttcaatacaa ccgaagtgaa gataaatttg gttggcgata caaagtgtaa       840
//

If you have problems or comments...

PBIL Back to PBIL home page