(data stored in ACNUC7421 zone)

EMBL: CP002157.PE498

CP002157.PE498       Location/Qualifiers
FT   CDS_pept        527049..527426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01182"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99944"
FT                   /db_xref="GOA:A4AVL4"
FT                   /db_xref="InterPro:IPR003691"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVL4"
FT                   /protein_id="EAQ99944.1"
FT                   /translation="MKQLLLVFLGGGLGSLLRYVVSKTFNNYFQHFYLGTFLVNVIGCL
FT                   IIGIVLGLSFKNNILSQNQTLLLTTGFCGGFTTFSTFALENQSLLKTGEILHFSVYTLS
FT                   SIAVGIAAVLIGLWVSKFFLT"
     atgaaacaat tattacttgt gtttttaggt ggtggtttgg gcagtttgct caggtacgtt        60
     gtttccaaaa cattcaataa ttattttcag cacttttatc tgggcacttt tttggtcaat       120
     gttatagggt gtctaataat aggtatagtt ttaggattat catttaagaa caatatcctt       180
     tcccaaaatc aaacattatt attaaccaca ggtttttgtg gtggtttcac aactttttca       240
     actttcgcac ttgaaaatca atccttatta aaaacaggcg aaattcttca cttctctgtt       300
     tatacccttt caagtattgc cgttggaatt gctgcagtgc ttatcggttt atgggtttcc       360
     aagttttttt tgacctag                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page