(data stored in ACNUC7421 zone)

EMBL: CP002157.PE504

CP002157.PE504       Location/Qualifiers
FT   CDS_pept        532551..533288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01212"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99950"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVM0"
FT                   /protein_id="EAQ99950.1"
FT                   /translation="MRTILLTIFICLFFLGCNFKKDSQTTVVENKRHLPKLEQNRYNVA
FT                   FLIMDGTYNTEFTAPFDIFQHTQFRKGIKAMNTFTVANTLDPITTFEGVRVLPDFDYTN
FT                   DSLPHIDILVVPSAEHHLDSDLKDNQMLNFIKKVDENALYMTSHCDGAFVLAQAGVLDD
FT                   VTSTTFPSDIALYRKTFPQLSVEDNVLFVHDGKYITSAGGAKSFEAALYLCEVLYGKEI
FT                   TESLAKGLVIDWDITKVSHLTLQ"
     atgagaacta tattattgac catattcata tgcctctttt ttcttggatg taattttaaa        60
     aaagactcgc aaacaacagt ggtagagaac aagcggcatt tacccaaatt ggaacaaaat       120
     agatataacg tagcttttct tattatggat ggcacttata acaccgaatt cactgccccc       180
     tttgacatat ttcagcatac acaattcaga aagggtatta aagcaatgaa cacttttacg       240
     gttgccaata cattagaccc aataaccact tttgagggtg tgcgggtatt acccgatttt       300
     gactatacca atgattctct tcctcatata gatatacttg tggttccaag tgccgaacac       360
     caccttgatt cagacttaaa ggacaaccaa atgttgaatt ttatcaaaaa agttgatgaa       420
     aatgcgctgt acatgacctc acattgcgac ggtgcatttg tacttgcaca ggcgggagtt       480
     ttagatgatg tgacatcaac aacattccca agtgatatag cattgtatcg caaaacattt       540
     cctcagttaa gtgttgagga caatgttctc tttgttcatg acggtaaata tataacctct       600
     gctggaggag ctaaaagttt tgaagccgcc ctgtatttat gtgaagtact ctatggaaaa       660
     gaaattacag aatccttagc aaagggattg gttattgatt gggatattac caaagtatca       720
     catcttactc ttcaatga                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page