(data stored in ACNUC7421 zone)

EMBL: CP002157.PE505

CP002157.PE505       Location/Qualifiers
FT   CDS_pept        complement(533275..534687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01217"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01217"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99951"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVM1"
FT                   /protein_id="EAQ99951.1"
FT                   /translation="MKKILLVLTLSVSFLSSAQQLTLKKGMIMDRIAVNDTISEDFALF
FT                   LPTKFDTAKVWPVIFVFDMQGRGKKVLSMLSGAAEKNNYIIAASNKVNDTLSITQNVLI
FT                   TKRMFDAVFSMFRIHKERIYTAGFDGGARMASAMPIFLNNIKGVISCGASVGNRDLLSS
FT                   KKRFHFIGIVGNEDFNYPEIRKQESLFNLMKFPNETLVFDGGHKWPSQQLLSRAIEIFD
FT                   LEAMSKNIIPRDSVFIKDTYLRDLNNTNNLISENRFLIAHQKLEDILKIYRPLLKVDSL
FT                   KNSLKTIRRSQAFKSQKRNQNSVLFKESFVKSEYDYALEEDVFTYNYNNLGWWNYQMGV
FT                   LKKFKESDNISQRQMGVRLEGYLNALIADSIDIINENSPIDEEGLNYLWMLKTITTPDD
FT                   FSYYLKVISLNAKVEDYGTSLYYLEELLKLGYSNSDELYSLENTALFRITPEFNKLVEK
FT                   YLKKARYEIIEE"
     atgaaaaaaa tattacttgt acttacctta agcgtttcct ttttatcatc agcacagcag        60
     ctaacactca agaagggtat gattatggat cgcattgctg taaatgatac aatttctgaa       120
     gattttgcgc tctttttacc taccaaattt gatactgcta aagtgtggcc tgtaattttc       180
     gtttttgata tgcagggtag gggtaaaaag gtgcttagca tgctttctgg ggccgctgaa       240
     aaaaacaact acataattgc tgcttcgaac aaagtgaatg ataccctatc gattacccaa       300
     aacgtgctta taaccaagag aatgttcgat gccgtgtttt cgatgttcag aatacataaa       360
     gagagaattt acacagctgg ttttgatggg ggtgctagaa tggcttctgc gatgcctatc       420
     tttttgaata atattaaagg ggttatttca tgtggcgcct cggtagggaa tagggatttg       480
     ttgtcaagta aaaaacgttt ccactttatt ggtattgttg gtaatgaaga ctttaattac       540
     cctgaaataa ggaaacagga aagccttttc aatttaatga aattccctaa tgaaaccttg       600
     gtttttgatg gaggtcataa atggccctct caacaattgc tttcccgggc cattgagatt       660
     tttgatttgg aagcaatgtc taaaaatata atacctagag attctgtttt tataaaagac       720
     acatatctgc gggatttaaa taataccaac aatttaattt ctgaaaatag atttttaata       780
     gcccatcaaa agttagaaga tatattgaag atttatagac cattgttaaa ggttgattct       840
     ttaaaaaaca gtttaaaaac tatacgacga agtcaagctt ttaaaagtca aaaacgaaac       900
     cagaactcag ttctatttaa ggagtccttt gttaagtctg agtacgacta tgctcttgaa       960
     gaagatgttt ttacctataa ctataataat ttaggatggt ggaattatca aatgggtgta      1020
     ctgaaaaagt tcaaggaaag tgataatata tcccaaaggc aaatgggagt aaggttggag      1080
     ggttatttaa atgccctaat tgccgatagt attgacatta ttaatgaaaa ttctccaatc      1140
     gatgaggaag gactcaacta tctttggatg ttgaagacca tcacaactcc cgatgatttt      1200
     tcttattatt taaaggttat ttctttaaat gccaaagttg aagactatgg gacttccctt      1260
     tattatttag aagagctgct gaaactaggg tattcgaatt cagatgagct ttattcattg      1320
     gaaaatactg ctttatttag aataacacca gagtttaata aattagtaga aaaatatttg      1380
     aaaaaagcca ggtatgaaat cattgaagag taa                                   1413
//

If you have problems or comments...

PBIL Back to PBIL home page