(data stored in ACNUC7421 zone)

EMBL: CP002157.PE506

CP002157.PE506       Location/Qualifiers
FT   CDS_pept        complement(534749..535573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01222"
FT                   /product="mechanosensitive ion channel family protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01222"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99952"
FT                   /db_xref="GOA:A4AVM2"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVM2"
FT                   /protein_id="EAQ99952.1"
FT                   /translation="MDMDKINEYIQIAIDKAVFFLPKILLAILILWIGFKVAKKLVHWV
FT                   NLALEKAGFSETLRPFLSSTLSVILKGVVLFTIAMVIGADLTGLVAILAAAGFAVGMAL
FT                   QGSLGNFASGILILTFKPYKIGDWIQLEDKFGRVEEIGIFSTDVLTPGNKILIIPNSKV
FT                   TDSVVTNYSEKGMIRLELEVTMPYAESFPKVKIIILDTLSRIPKVLNDPLPEIGINTFD
FT                   SHSIQLLVRPYVLPDDYWEVTFQTNEAIKSAFSTNEIKVAYSEGIEIGNIGE"
     atggacatgg ataaaatcaa tgaatatatt caaatagcaa ttgataaggc ggttttcttt        60
     ttgcccaaga ttcttttggc tattctaatc ctttggattg gatttaaagt agcaaagaaa       120
     ttggttcatt gggtgaactt agctctggag aaggcgggtt tttcagaaac tttgcgtcca       180
     tttttgtcat cgacgttatc agtaattctt aaaggagttg ttctttttac aattgcgatg       240
     gttatagggg cagacttgac tggccttgtg gccattttag ctgccgcagg ttttgctgtt       300
     ggtatggcac ttcaaggaag cctggggaat tttgcctcgg ggattttaat tttgaccttt       360
     aaaccatata agatcggtga ttggattcaa ttggaagaca agttcggtag ggttgaggaa       420
     ataggtattt tcagtaccga tgtgcttaca ccgggaaata agattttaat tattcccaat       480
     tcgaaagtga ctgactccgt tgtgaccaat tattctgaaa aagggatgat aaggttagag       540
     ttagaagtga ccatgcctta tgcagagagt ttccctaagg ttaaaataat aatactggat       600
     acattatcaa ggattccgaa agtactcaat gacccattac cagagattgg catcaatact       660
     tttgattccc atagtataca attattggtg aggccttacg ttttgccgga tgattattgg       720
     gaggtgactt ttcagaccaa tgaggcaata aaaagcgcct ttagcacaaa tgaaataaag       780
     gttgcctatt ccgaaggaat cgaaattggt aatattggtg aatga                       825
//

If you have problems or comments...

PBIL Back to PBIL home page