(data stored in ACNUC7421 zone)

EMBL: CP002157.PE513

CP002157.PE513       Location/Qualifiers
FT   CDS_pept        543933..545600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01257"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01257"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99959"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR041662"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVM9"
FT                   /protein_id="EAQ99959.1"
FT                   /translation="MSTKYKISIAICAMFVLLGSCESVDLNVNNDPNNASPDNSDVNLL
FT                   LNGAMLNFTSWIGEEDEDNREGFQAGMQVVRMLHMFGPLYENAFEPGDFDDVWRQSFSG
FT                   HLSDIQTIKKNAIENNLSHHLGVAQILESYTLTVLVDYFGDIPYSEAFAGAENFDAALD
FT                   DDAAVYGIAMSLLDEAIANLALSPASSISSTGDLFYFGDLDKWTTLAKTLKLRIYNNTR
FT                   LVDSNALAGINALLADGDLIDSASEDFTVFYGTNSSSPDIRHPQFINNYENTPSGEYMS
FT                   MYFMNLLVNGFDSPDPRTRYYIYRQVDEYPPADAQGIFDFPCLAESYPTHYVPGVDPFC
FT                   TSIGDGYWGRIHGDNQGLPSDSDKITTWGTYPIGGKFDDDSFSAVTKSSGMSGAGIQPI
FT                   MLSSFVYLMRAEAALTLGTTDDAAAMLEAGIRASLNKVINFDSSINSPLAATATNIDDY
FT                   VNEIITDYGAGSDAEKLNIIMTQAFISSWGNPVEAYNNYRRTGMPLNLQPTQTSTPGAF
FT                   IRSFKYPSVAIDNNPNINPKENQGVKVFWDTNSTNLDF"
     atgagtacaa aatataaaat atctatagcc atttgtgcaa tgtttgttct gttaggctct        60
     tgtgagtcgg tagatttaaa cgtgaacaat gacccaaata atgcttcacc ggacaattca       120
     gacgtcaatt tactattgaa tggtgccatg ctgaacttta catcatggat tggtgaagag       180
     gatgaagata accgtgaagg atttcaagca ggaatgcagg ttgttagaat gctccatatg       240
     tttgggcctt tgtatgaaaa tgcttttgag ccgggagatt ttgatgatgt ttggaggcaa       300
     agtttttccg gtcacttatc tgatattcag accattaaaa agaatgcaat tgaaaataat       360
     ttatcgcatc atttaggggt ggctcaaatt ttggagtcct atacgctaac tgttttggtt       420
     gattattttg gtgacatccc ttattcagag gcattcgccg gggctgaaaa ttttgacgct       480
     gcgctggatg atgacgctgc tgtttatggt attgccatgt cattgctaga tgaggcaatt       540
     gcaaacttag cactttctcc agcttcaagt atttcttcga caggagattt gttctacttc       600
     ggtgatttag ataaatggac caccttagca aaaactttaa aattaagaat ttacaacaat       660
     acgaggttgg ttgattctaa tgccctagca gggataaacg cgcttttggc tgatggtgat       720
     cttatcgatt cagccagtga agattttacg gttttttatg gcaccaattc atcctcacct       780
     gatatcagac atcctcaatt cattaataat tatgaaaaca ctcctagtgg tgagtatatg       840
     tcaatgtatt ttatgaatct attggtaaat ggtttcgatt cccctgatcc aaggacaaga       900
     tattatatct atagacaggt tgatgaatat cctcctgccg atgcccaagg tatatttgat       960
     tttccatgtt tagcggaaag ttatcctacg cattatgttc ccggtgttga cccgttctgt      1020
     acttctatcg gtgatggtta ctggggtaga attcatgggg ataaccaagg tctgccttca      1080
     gattctgaca agataacgac ttggggcacc tacccaattg gtggaaaatt tgatgatgat      1140
     tcattctcag cagttactaa atcctcagga atgagtggtg ccggaattca accgattatg      1200
     ttatcatctt tcgtgtacct aatgagggcc gaagccgcct taacgctagg aacaacagat      1260
     gatgcagctg caatgttaga agctggcatt agagcttctt taaataaggt tatcaatttt      1320
     gacagtagta taaatagtcc gttggccgct acagcgacga atattgatga ttatgtgaac      1380
     gaaattataa ctgattatgg agcaggatct gatgcagaaa aactcaatat tattatgacg      1440
     caagcattta tatcatcttg gggtaaccca gttgaggcgt acaataatta taggagaaca      1500
     ggaatgccgc taaacttgca gccaacgcaa acctcaacac ctggcgcttt cattaggtca      1560
     tttaaatacc cttctgtcgc aatagacaac aatccaaata tcaatcctaa agaaaatcaa      1620
     ggtgtaaagg tattttggga tactaattca acaaacttag atttttaa                   1668
//

If you have problems or comments...

PBIL Back to PBIL home page