(data stored in ACNUC7421 zone)

EMBL: CP002157.PE514

CP002157.PE514       Location/Qualifiers
FT   CDS_pept        545612..546487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01262"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01262"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99960"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVN0"
FT                   /protein_id="EAQ99960.1"
FT                   /translation="MKRIIKLIALPCILLGFISCEDEDKARITPYADETQGAFLRTIDA
FT                   GGVINRTDIAGSSYSITGELVAASNDDVSNVEIMVEFVDRTTDDDPGTNDDESIDPVLV
FT                   ASADVSTFVSNSNGLPETTFDIGISDATTALGLDLGDIEGGDQFLFWVVINMQDGTKFE
FT                   KGNSGDSVTGELFFSSPMVYTGSVVCILPMPPAGDWIIEMVDSYGDGWDGAFITATING
FT                   TGTDYTATDFGTNHTVNVPQGSSSLIFTYTPGNFESEHSFTIKAPSGNIVSEQGPGPTA
FT                   GEITLNLCNE"
     atgaaaagaa ttataaaact aattgcattg ccttgtattc tactgggctt catatcttgt        60
     gaagatgaag ataaggcccg tattacacct tacgccgatg agactcaggg agcattctta       120
     agaactattg acgctggtgg agtaataaat aggaccgaca tagctggttc atcttattca       180
     ataacagggg aattagtagc cgccagtaac gatgatgttt caaatgtaga aattatggtt       240
     gagttcgttg accgaaccac agatgatgat ccaggaacaa acgatgatga gtcgatagat       300
     cctgttttag ttgcttctgc tgatgtttca actttcgtta gtaattcaaa tggtttgcca       360
     gaaaccactt ttgatattgg catatcagat gctactactg ctttaggttt ggatcttgga       420
     gatattgagg gaggtgatca atttctcttt tgggtggtca taaatatgca agatggcaca       480
     aagttcgaaa aaggaaatag cggtgatagt gttacaggag aactgttttt tagttcccca       540
     atggtttaca ctggctctgt agtttgtatt cttcctatgc ccccagctgg agattggata       600
     attgaaatgg ttgattccta tggcgatggt tgggacggag cttttataac ggcaactatt       660
     aatggcactg gaactgacta tacggcaacc gattttggca caaaccatac ggttaatgta       720
     cctcagggct catcgtcact aattttcaca tatacgccag gtaattttga atcagaacat       780
     tcattcacaa taaaagctcc tagtggcaat attgtttcag aacaaggtcc tggtccaaca       840
     gctggcgaaa tcactcttaa tctttgcaat gaataa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page