(data stored in ACNUC7421 zone)

EMBL: CP002157.PE515

CP002157.PE515       Location/Qualifiers
FT   CDS_pept        complement(546777..547289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01267"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01267"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99961"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVN1"
FT                   /protein_id="EAQ99961.1"
FT                   /translation="MKKLRTHFLICFLLIFGFSGIAQDSCNCCSENHKAFDFWIGSWDV
FT                   VNPDGSAAGKSTIVKSEGDCVVRENWVSAKDGYTGTSTNFYNKVAEEWEQLWVDNSGAH
FT                   LKLKGNRKKNQMILSSTEVKNKSGVLIKNRITWTSNDDGTVRQLWEITHEGKVISVAFD
FT                   GLYKKVE"
     atgaaaaagc ttagaactca ctttctcatt tgttttttgt taatatttgg cttctctgga        60
     atagcacaag attcttgtaa ttgttgctca gaaaaccaca aagcgtttga tttttggata       120
     ggttcgtggg acgttgtaaa tcccgacgga agtgctgccg gtaaaagcac aatagtaaaa       180
     tcggaagggg attgtgttgt ccgtgaaaat tgggtcagtg ctaaagacgg gtatactggg       240
     acaagtacaa atttttataa caaagtagcc gaagaatggg aacaattatg ggttgataac       300
     tctggagctc atttaaaact aaaaggtaat agaaagaaga atcagatgat actttcctcg       360
     acagaagtga aaaacaagag tggtgtatta attaagaata gaatcacttg gacctcgaat       420
     gatgacggca ctgtacgtca attatgggag ataacccacg agggaaaagt aattagtgta       480
     gcttttgatg gtctttacaa aaaagttgaa taa                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page