(data stored in ACNUC7421 zone)

EMBL: CP002157.PE519

CP002157.PE519       Location/Qualifiers
FT   CDS_pept        complement(549357..550433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01287"
FT                   /product="peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01287"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99965"
FT                   /db_xref="GOA:A4AVN5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVN5"
FT                   /protein_id="EAQ99965.1"
FT                   /translation="MIDKLNIVKQRFDEVSDLIIQPDVISDQKRYVQLTKEYKDLKDLM
FT                   EKRDAYVELTNNIQEAEEIISDGSDAEMLEMAKMQLDEAKTALPKLEEDIKLMLIPKDP
FT                   EDAKDVVVEIRAGTGGDEASIFAGDLFRMYTKYCEGRGWKTNVIDLSEGTSGGYKEIQF
FT                   EVSGADVYGTLKFEAGVHRVQRVPQTETQGRVHTSAATVMVLPEAEDFDVQIDPKDVRI
FT                   DFFCSSGPGGQSVNTTYSAVRLTHIPTGLVAQCQDQKSQHKNKDKAFRVLRSRLYDLEL
FT                   ARKQEEDAAKRNSQVSSGDRSAKIRTYNYAQGRVTDHRIGLTLYDLQNIINGDIQKIID
FT                   ELSLVENTEKLKEASEIF"
     atgattgata aattaaatat tgtaaaacag cgttttgatg aggtttccga cctaattata        60
     caacctgatg tgatttcgga tcaaaaaagg tatgtccaat taaccaagga atataaggat       120
     ctaaaagacc ttatggaaaa acgtgatgcc tatgttgaac ttacaaacaa cattcaagag       180
     gcagaagaga ttatctctga tgggagcgat gccgaaatgt tggaaatggc aaaaatgcaa       240
     ttagatgaag caaaaacggc tttgccaaaa ttagaggagg atataaagct gatgttgatt       300
     ccaaaagacc ctgaagacgc caaagatgtt gtcgttgaga ttagggcagg aacgggaggt       360
     gatgaagcta gtatttttgc aggtgatctc tttagaatgt acaccaaata ttgtgaaggt       420
     agaggttgga aaaccaatgt aatagattta agtgaaggta ccagtggtgg ttataaagaa       480
     atacagtttg aggtgagtgg ggcggatgtt tatggcactt taaaatttga agcaggtgtt       540
     caccgtgttc aacgtgttcc gcaaacagaa acacaaggtc gggtgcatac aagtgccgca       600
     accgttatgg ttttacccga ggctgaggat tttgatgtac agattgatcc aaaagatgtt       660
     aggattgatt ttttctgctc ttctggccca ggtggtcagt cggtgaacac aacatattcg       720
     gcagtacgcc ttacccatat tcctactggg ttggtggcac agtgtcaaga tcaaaaatcc       780
     cagcataaaa ataaagacaa ggcttttagg gttttgcgct caagattata tgatctagag       840
     ttagccagaa aacaagagga agatgcggcg aaacgaaatt ctcaggtaag tagtggggac       900
     cggtcagcta aaattaggac ctataactat gctcaaggtc gtgttactga tcacaggatt       960
     ggtttaacac tttacgattt gcagaatatt atcaatggtg atattcaaaa aatcattgat      1020
     gagttaagct tggtagagaa tacggaaaaa cttaaagaag cttcagagat attttaa         1077
//

If you have problems or comments...

PBIL Back to PBIL home page