(data stored in ACNUC7421 zone)

EMBL: CP002157.PE52

CP002157.PE52        Location/Qualifiers
FT   CDS_pept        65796..66188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16391"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00681"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATB1"
FT                   /protein_id="EAR00681.1"
FT                   /translation="MHIETPKRTVNKSSQEVFEFLTKLENFEKLMPENIDKFEVINEDR
FT                   FLFALKGMPEIVLQRNEQHPNNKIVLGAASDKLPFTLTADIIELGENESEIILSFAGEF
FT                   NAMMAMMIKSPITKFMGTLSENLDSI"
     atgcatatag aaactcctaa aaggaccgta aataaaagta gtcaagaagt atttgaattt        60
     ttgaccaagc tcgagaattt tgaaaaattg atgccggaaa atatagataa attcgaagtc       120
     atcaacgagg accgttttct ctttgcactt aaaggaatgc ccgaaattgt gcttcagcga       180
     aatgagcaac accctaataa taaaatagtt ttaggcgcag caagtgataa attgcccttt       240
     accctgacgg ctgacattat tgaacttgga gagaatgaaa gtgaaatcat cttgagtttt       300
     gcaggtgagt tcaatgcaat gatggccatg atgattaaat cgcccattac taaattcatg       360
     ggcaccttat cagaaaattt agattcaatt taa                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page