(data stored in ACNUC7421 zone)

EMBL: CP002157.PE520

CP002157.PE520       Location/Qualifiers
FT   CDS_pept        complement(550536..551816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01292"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01292"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99966"
FT                   /db_xref="InterPro:IPR021953"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVN6"
FT                   /protein_id="EAQ99966.1"
FT                   /translation="MKNLWVLFFILIISGSFAQDGNTNSYKKRVLETAEIDLLFSFYDQ
FT                   DGQNAAVSGGEGTEKLTDATSSIVVKIPLNADDVLTVDAGISAYSSASTSNVDPFDKNS
FT                   RRASPFSASSGASQSDVLAHFNPSYEHSSDDRNSVYRAQAYVSSEYDYFSIGFGGGYTR
FT                   LFNEKNTEVSADLQVFLDNWIPQYPVELRGGFSDSRITGTGTYNPVFNAFNDETRNSYS
FT                   LSLSFSQILSQRMQGSIFMDIVSQSGLLSTPHQRVYFGDVNDFFIEDFQLADNVEQLPN
FT                   SRFKIPIGARLNYYVNDLFVLRSYYRYYSDDWGITAHTASLEVPIKLTDKFTFYPNYRY
FT                   YSQTAADYFYAKEAAISSLDFYTSDYDLSAYDSHQYGMGIRYKDIFTSAKVFTFGLKTI
FT                   DFRFGKYDRSDGLDSFIFSLGTTFVGD"
     ttgaaaaatc tctgggtttt attttttatt ttaataatca gcgggagttt tgcccaagat        60
     ggcaatacga atagttacaa gaaaagagtg cttgagactg ctgaaattga tttgttgttc       120
     agtttttacg atcaagatgg tcagaacgct gctgtatcgg ggggagaagg taccgaaaaa       180
     cttacagatg ctacatcgag cattgtggtt aaaattcctt tgaatgccga tgatgtcctt       240
     accgttgatg caggtatatc cgcatattcc tcagcttcta ccagcaatgt ggatccgttc       300
     gataaaaaca gtagacgagc aagcccgttc agtgcatctt ctggagcttc ccaaagtgat       360
     gttttagccc attttaaccc ttcctatgag catagttctg atgatagaaa ctcggtttat       420
     agggcccaag cctatgtctc ttctgaatat gattattttt caattggttt tgggggagga       480
     tatactcgtt tgtttaacga aaagaatact gaggtatctg cggaccttca agtgttttta       540
     gataattgga ttcctcaata tcccgttgaa ttacggggtg gtttttcaga ttctaggata       600
     acgggcaccg gtacttacaa tccagttttt aatgcattca atgatgaaac aagaaattca       660
     tactcacttt ctttaagttt ttctcaaatc ctaagccaaa gaatgcaagg ttctattttt       720
     atggatattg tgtcgcaaag tggattactg agtacacctc accaaagagt atattttggt       780
     gatgtgaatg atttctttat tgaagatttt caattagcgg ataatgttga gcaattgccc       840
     aatagtcgtt ttaaaattcc tatcggagct cgtttaaatt attatgtcaa cgatttgttt       900
     gtattgcgta gttattacag gtattattca gatgattggg gtattacggc tcacactgca       960
     agtctggaag tccctattaa actaacagat aaattcacct tttatccaaa ttatagatat      1020
     tacagccaaa cggcagcgga ttatttttat gcaaaagaag ctgcaatttc cagtttggat      1080
     ttttatactt ccgattatga tctttcggcc tatgattcgc atcaatatgg gatgggaatc      1140
     aggtataaag atattttcac cagcgccaag gtttttactt ttggattaaa gaccattgat      1200
     tttaggtttg gtaaatatga ccgaagcgat ggtttggatt cctttatttt tagtttggga      1260
     actacctttg ttggagatta a                                                1281
//

If you have problems or comments...

PBIL Back to PBIL home page