(data stored in ACNUC7421 zone)

EMBL: CP002157.PE537

CP002157.PE537       Location/Qualifiers
FT   CDS_pept        complement(569789..571702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01377"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99983"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR024302"
FT                   /db_xref="InterPro:IPR041662"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVQ3"
FT                   /protein_id="EAQ99983.1"
FT                   /translation="MKNVLSKKLALFSALLLIFSCSDFEEINENPLAATAEQVEVEFFI
FT                   NNSIQAAQQNPHIAERIFRLYWMDAGRSARVGTLSEGFTNDGWTNDYFQSYVSRWLRDI
FT                   TTGVSVAEEKIATGNVKEYTENLLHVARIWRVYILSEMTDNFGPIPIDGFQGENPEYNS
FT                   VEEVYTFMLAELADAVSQIDESNTFKPDGNLDPAFGYDYAKWKKYGNSMRMRLAMRLSE
FT                   VAPGVAQQHFEAAANSGEIIAVPGDDMSVYEEGGWNNYTNVMSRQWNSNYISATYKNIT
FT                   VGLGSVTSLDQLPVEDQINIKPAGYLGMKFDDHFTQLTNDPAKGFFFDGLPNTIDPRAY
FT                   KTFPIPGNQDDPQFSNFPTWSSNHTLTERDLLDDAGEVQLTLDCAFTYNAFAAGEWGDF
FT                   GTKNQLIASGSYPRLGLNFRGAGETKRRIFFPSWETHFLIAEAAVRGWNVPMSGQAAYE
FT                   QGIADSFAYFGVSDHLGTYIASQDYNNAGTSVSWSHTTEPPASVTMDYVDGYTGTPGTY
FT                   EFTYPENTIYEGGTVKNDLLTKIITQKYIAQTPWLGLEAWSDHRRLGLPFFENPAIENP
FT                   IPELPILNSGNVLTNQIGFFGQRLKYPSSFENNVPAGHAQALGLLGGADNVHTPLWWAQ
FT                   QN"
     atgaaaaatg tattaagtaa aaaactggca ctattcagtg ctttgctatt gattttttct        60
     tgtagcgatt ttgaggaaat caatgagaac cccttggctg caaccgcaga gcaagtagaa       120
     gtagaatttt ttattaacaa ttctattcaa gcagcacaac aaaacccaca tatagctgaa       180
     cgtatttttc gtctatattg gatggatgca gggaggtcag cacgtgtagg taccctatcg       240
     gaaggtttta caaacgatgg atggaccaat gactattttc aaagttatgt atccagatgg       300
     ttgcgtgata ttactaccgg tgtttctgta gcagaggaga aaattgccac tggaaatgtc       360
     aaggaatata ccgagaattt actgcatgtt gcacgaattt ggagagtcta tattttgagt       420
     gaaatgactg ataactttgg gccaatacct attgatggct tccaaggtga aaaccctgaa       480
     tacaatagtg ttgaggaagt atatactttt atgttggcag aattggcaga tgctgttagc       540
     caaatagatg aatcaaatac attcaagcct gatggtaatc ttgatcctgc ttttggatat       600
     gattatgcta aatggaaaaa gtatggtaat tctatgcgta tgcgtttggc tatgcgttta       660
     tctgaagttg cacctggtgt tgcccaacag cattttgaag ctgcagcgaa tagtggagag       720
     attattgctg taccgggcga tgacatgagt gtttatgaag aaggcggatg gaataactat       780
     accaatgtaa tgtctagaca atggaatagt aattatataa gtgctactta caaaaatata       840
     actgtaggct tgggtagtgt tacgtctttg gatcagttac cggttgaaga tcaaattaat       900
     ataaaacctg ccggttacct aggtatgaaa tttgatgatc actttacaca acttacgaat       960
     gacccagcta aaggtttctt ttttgatgga ctaccaaata caattgatcc tagagcgtat      1020
     aagacgttcc caattcctgg aaatcaggat gatccccagt ttagtaattt cccaacttgg      1080
     agtagtaatc atacgttgac ggaaagagat ttattggatg atgctggcga ggttcaactt      1140
     actttggatt gtgcttttac ctataatgct tttgcagctg gtgaatgggg agattttgga      1200
     acgaagaacc aattaatagc ctcagggtct tacccacgtt taggacttaa tttcagagga      1260
     gctggagaaa ccaaaaggcg aatatttttc ccttcttggg agacacattt cttaatagcg      1320
     gaagctgctg ttaggggttg gaatgttcca atgagtggcc aggcagccta cgagcaaggt      1380
     attgcagata gttttgcata ttttggggtt tctgatcact taggaacgta tattgcttct      1440
     caggattata ataatgctgg aacatcagta agttggagtc atacgaccga acctcctgca      1500
     agtgtaacta tggattatgt tgatggatat acgggtacgc caggtactta tgaatttaca      1560
     tatcctgaaa acacaattta cgaaggtggt actgttaaaa atgatctttt gactaagatt      1620
     attactcaaa agtatatagc acaaacacca tggttaggtt tggaagcatg gagtgatcat      1680
     agaaggttag gtttgccatt ctttgaaaac cctgctattg aaaacccaat tccggaattg      1740
     ccaatactaa atagtggtaa tgtgttgact aatcaaatag gcttctttgg acaacgttta      1800
     aaataccctt cgtcttttga aaataatgtt ccagctggtc acgcgcaagc tctagggcta      1860
     ttaggaggtg cagataatgt gcatacacca ttgtggtggg cacaacaaaa ttag            1914
//

If you have problems or comments...

PBIL Back to PBIL home page