(data stored in ACNUC7421 zone)

EMBL: CP002157.PE539

CP002157.PE539       Location/Qualifiers
FT   CDS_pept        complement(575075..577306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01387"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01387"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99985"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR032287"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVQ5"
FT                   /protein_id="EAQ99985.1"
FT                   /translation="MKINLIIAFVAVVILNTSCSDSSINLVENGVSDYEIVFKGDATKE
FT                   VYKSAEVLQAYLEKISGARLDIVDESSQTVKNKIYIGNINDEELGVHQLKITTSDENLI
FT                   ISGGSDKAINNAVYVFLENYLGCKWYSPTVEKIPESNSVSIPLTINYSFTPEITTRTVH
FT                   SRLFYENHDYADKQKVTYEAFPKYVPKARVHTFHRFVPEEKFYKSNPEFYAWRGEKRLP
FT                   TQLCLTNETVLSIVKDSVKAMFERNPEASVISVSQDDNQQYCLCDSCSAIDKAEGSPAG
FT                   TMIHFVNKVAEAFPDKIISTLAYQHTRKPCKTQPAENVLITLCSIECDRSGPIEDKCAD
FT                   FSEDLKGWGKLTDNIRIWDYTTQFTNFLAPFPNIHTLKPNIELFKNNGAQWIFEQHSNN
FT                   PSELFELRSYITAKLLWDPTLELNGLVTEFTNGYYEEAGDFIKQYVDLVHTKIKADPEF
FT                   FLFLYGDPSQAFDSFLSAELLSEYSILFDKAEKAINDSPEVLKRVKRARLGIDYAVLEA
FT                   SRKGISEQFKLIVNEGGNMKINPLVEKLLNDFKKTTDEGEILLMNEMGFTVAEYLSSYQ
FT                   KALDVAIQPNIALGKKVQLLTTPKKYADEDPQVLTDGALGGNGFYANWLGFEGNDLEAV
FT                   VDLGTSQEIAYISVAFLQVTNHVVFYPTKVTYYGSADNKNFEVLGTLENKNPLSKKSKV
FT                   NDIQYFDLKEINKNIRYLKIRANNMGQPPYWHHAAGTPAWIFADEILVN"
     atgaaaatta atttaataat cgcttttgtt gctgttgtaa tcttaaatac ttcttgttct        60
     gattcctcga taaaccttgt tgaaaatggt gtgtcggact atgaaattgt ttttaagggc       120
     gatgctacga aggaagttta taaatctgct gaggtattac aagcttatct agaaaaaatt       180
     agtggtgctc ggctagatat tgttgatgag agttctcaaa ctgttaaaaa caaaatatac       240
     atcggcaata tcaatgatga ggaattaggg gttcatcaat taaaaatcac cacctcagat       300
     gaaaatctga ttatttctgg aggctcagat aaggcaatca ataatgcagt ttatgttttt       360
     ttggaaaatt atttagggtg caaatggtac tcacctacag ttgaaaaaat tccagagtct       420
     aattctgttt caataccgtt aactatcaat tattcattta ctccagaaat cacaaccaga       480
     acggttcatt caaggttgtt ttatgaaaac catgattatg ccgataagca gaaagttacg       540
     tatgaagcat ttcccaaata cgttcccaaa gctcgggtac atacattcca ccgatttgtt       600
     ccagaagaaa aattctataa atccaatcct gagttttatg cctggcgagg cgaaaaacgt       660
     ttgccaaccc aattgtgttt aaccaatgaa actgtattga gcattgtaaa ggattctgtt       720
     aaggcgatgt ttgaaagaaa ccctgaagct tcggtcatat ctgtgagtca agatgataac       780
     caacaatact gtttatgtga ttcctgtagt gccatagaca aagcggaagg aagtcctgcg       840
     ggcaccatga tccatttcgt gaacaaggta gctgaggcat ttccagataa aatcatttca       900
     accttggcct atcagcatac aaggaagccg tgtaaaacgc aacctgctga aaatgtgttg       960
     ataacacttt gttctattga atgtgaccgt agtggtccca tagaggataa atgcgctgat      1020
     ttttctgaag acttaaaagg ttgggggaaa ttaaccgata atattcgcat ttgggactat      1080
     accacccaat tcacgaattt tttagcgccc tttccaaaca tccacacact taaacccaat      1140
     attgaattat ttaagaacaa tggcgcccag tggatttttg aacagcatag taataatccc      1200
     agtgaattgt ttgaattacg ttcttatatc actgcaaaac tcttgtggga tcctacatta      1260
     gaattgaatg ggttagtgac tgagtttacg aacggttatt acgaagaggc aggtgatttt      1320
     ataaaacaat atgttgattt agtgcacaca aaaataaaag ctgatccaga gtttttcctc      1380
     tttttatatg gtgatccatc acaagcattt gattcatttt tatcagccga attactatca      1440
     gaatactcta ttttgtttga taaggcggaa aaggctataa atgatagtcc ggaagtttta      1500
     aaaagagtga aaagagcgcg attaggtatt gactatgcag tgcttgaagc ttctagaaaa      1560
     gggatttccg agcagtttaa acttattgtt aatgaaggcg ggaatatgaa aatcaatcct      1620
     ttggttgaaa aattgctcaa tgatttcaaa aagaccacag acgagggtga aatactattg      1680
     atgaacgaaa tgggattcac ggttgccgaa tatttgagtt cttatcaaaa agctttggat      1740
     gttgccatcc agcccaatat tgctttgggc aaaaaagtgc aattattgac aacgccaaag      1800
     aaatacgccg atgaagatcc acaggtattg actgatggag ccttgggtgg taatgggttt      1860
     tatgccaatt ggttaggttt tgaaggcaat gatttggaag ccgtagttga tttaggaact      1920
     agtcaagaga tagcctatat ctcggtggct tttttacaag taacgaacca tgttgttttc      1980
     tacccgacca aagtaaccta ttatggctct gcggataata aaaacttcga ggttttggga      2040
     acgttggaaa ataaaaatcc gctctccaaa aaaagtaagg taaacgatat tcagtatttt      2100
     gatctaaaag agataaataa gaatattcga tatttgaaaa taagagcgaa taatatgggg      2160
     cagccaccat attggcatca tgcggcagga acgccagctt ggatatttgc cgatgagatt      2220
     ctagttaatt ag                                                          2232
//

If you have problems or comments...

PBIL Back to PBIL home page