(data stored in ACNUC7421 zone)

EMBL: CP002157.PE54

CP002157.PE54        Location/Qualifiers
FT   CDS_pept        67015..67392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_16401"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_16401"
FT                   /db_xref="EnsemblGenomes-Tr:EAR00683"
FT                   /db_xref="GOA:A4ATB3"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:A4ATB3"
FT                   /protein_id="EAR00683.1"
FT                   /translation="MQKRKASADELIALILQGIEEVKGHDINLLDLREIENTVCDYFII
FT                   CNGTSNTHVNAIVGSIQKTVSKAIKDKPWHVEGEDNAEWVLMDYVNVVVHVFQKQIREY
FT                   YDIEGLWGDAKFTVIESSVNQ"
     atgcaaaaaa ggaaagctag tgcagatgag ttaattgcat taattttaca gggaatagaa        60
     gaagtaaaag ggcacgatat aaatttactg gacctaagag aaatagaaaa taccgtatgt       120
     gactacttta ttatttgtaa tggtacttcg aacactcatg taaatgcaat agtaggttca       180
     atccaaaaaa cagttagtaa agctattaaa gacaaaccgt ggcatgtaga aggtgaggat       240
     aatgcagagt gggtgttaat ggattatgtt aatgtagtag tacatgtttt ccaaaaacaa       300
     attagggaat actacgatat tgagggtctt tggggtgacg ccaaattcac ggtaattgaa       360
     agtagtgtaa atcagtaa                                                     378
//

If you have problems or comments...

PBIL Back to PBIL home page