(data stored in ACNUC7421 zone)

EMBL: CP002157.PE541

CP002157.PE541       Location/Qualifiers
FT   CDS_pept        complement(578678..580903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01397"
FT                   /product="putative outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01397"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99987"
FT                   /db_xref="GOA:A4AVQ7"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVQ7"
FT                   /protein_id="EAQ99987.1"
FT                   /translation="MRNKLIFLFCLTTSLVMGQYQPVDYVNPFIGTSNFGTTNPGPIAV
FT                   RGMANVSPFNVAGPQNLPLEKDSRWLSTPYVHENKFLTGFSHVNLSGVGCPELGVILAM
FT                   PITGELETDYLKYGSTYSNEESKVGYYSTTLDKYDIKVEATATTRVGVSKYSFPKGYSN
FT                   ILLNLGLGLTNEQGASVKVVSSTEIEGVRSVGSFCYYKPEEAYPVYFVARFSEPAAEFG
FT                   VWKRPTKYKGEEAQWMGYNGKTRIMKGYTKEVVGDSIGAYMHYNFDKPTQVEMKVGVSY
FT                   VSLENARENLEKETSDKSFEELLQEAQDEWNTYLSRIEVEGGSEDDKTIFYTALYHTLI
FT                   HPSTLNDVNGDYPKMKTRETLKTKGTRYTVFSLWDTYRNLHQLMSLVYPKQQSNMVKSM
FT                   LQIYDESGWLPKWELNATETTTMVGDPAGIIIADTYLKGIRDFDVEKAYEAMVKSADQL
FT                   KDNPLRPGIDDYITKGYLTTKTTKSGSVSTTQEYNITDYAIAQLAWEMGYKKDYKRFSK
FT                   RSISYRNLFDKEFNLLRPKNDDDSWLTPYNPESGANFEKNLGFIEGNAWQYTFMVTHDV
FT                   KGLIRLMGGQKNFAQRLQDVFDKNQFDMANEPDIAYPYLFNYVKGEEYRTQKMVRDLLK
FT                   KHFKNSPDGIPGNDDTGTMSSWAVLSMMGIYPVNPSEASYAITKPKFDKITMHLDDEYY
FT                   NGKTLEIKTKRESNKEAIRNIMIDGKAHKGYFIEHQKLVKASVITID"
     atgcggaata aattgatttt tcttttttgt ttgacaactt cactggtaat gggtcaatat        60
     caacccgttg actatgtaaa tccgtttatt ggtacttcaa attttggcac aacaaaccca       120
     gggccaattg ctgtgcgtgg tatggccaat gtatctcctt ttaatgttgc tggtccacag       180
     aatttaccat tagagaaaga tagccgatgg ttgtctaccc cttatgttca tgaaaataaa       240
     tttttaacgg ggtttagcca tgtgaatttg agcggtgttg ggtgtccaga attaggggtt       300
     attctagcaa tgccaattac tggggagcta gagaccgatt atttgaaata tggcagtacc       360
     tattccaatg aagagagtaa ggttgggtat tattcgacca cactggataa atatgatata       420
     aaagttgaag cgactgcaac gactagggta ggggtcagta agtattcatt tcctaaaggc       480
     tattcaaata tattgctcaa tttaggttta ggacttacca atgaacaggg agcaagtgta       540
     aaagtggttt cctctaccga aatagaagga gttcgctcgg taggttcatt ttgttattat       600
     aagccagaag aagcataccc agtttatttc gtggctcgtt tttcagaacc tgccgctgaa       660
     tttggggtat ggaaaagacc aacaaaatat aaaggtgaag aggcacaatg gatgggatat       720
     aatggaaaaa cccgaatcat gaaaggctat accaaagaag ttgttgggga cagtattggg       780
     gcttatatgc attacaattt tgataaacct acacaagttg aaatgaaagt gggagtttct       840
     tatgtgagtc ttgaaaacgc acgtgaaaat ctagaaaaag aaacttctga caagtctttt       900
     gaggagttgt tgcaagaagc acaagatgaa tggaacacct atctttcaag aattgaggtt       960
     gaaggtggta gcgaggatga taagacaatt ttttacactg cattatatca tacattgata      1020
     cacccaagta cgttgaacga tgtaaacgga gactatccta aaatgaagac gcgtgaaacc      1080
     ttgaaaacca aaggaacacg atacaccgtg ttttcactat gggatacata cagaaatctg      1140
     catcaactaa tgagtttggt atacccaaag caacaatcga atatggtgaa gagtatgttg      1200
     cagatctatg atgaaagtgg atggttgcca aaatgggaat tgaatgcaac cgagacaact      1260
     acaatggttg gtgatccagc aggtatcatc attgccgata cctatttaaa aggaattagg      1320
     gattttgatg tcgaaaaggc ttatgaggca atggttaaaa gtgccgacca attgaaggac      1380
     aaccctcttc ggccggggat tgatgattat attacaaaag ggtatttaac aacaaaaact      1440
     actaaaagtg ggtctgtatc aacaacacaa gaatacaata taacagatta tgccatagca      1500
     caacttgctt gggaaatggg gtataaaaaa gattacaagc gattttcgaa aaggtctatt      1560
     tcataccgta atttatttga taaggagttt aatctgctaa ggcccaaaaa cgatgatgac      1620
     agttggttaa ccccttataa ccctgaatcg ggagccaatt ttgagaagaa cctaggtttt      1680
     attgagggga atgcttggca atataccttt atggtcactc atgatgtgaa gggacttata      1740
     cgattaatgg gcggacaaaa gaattttgca caacgattgc aagatgtttt tgataagaac      1800
     caatttgata tggcaaacga gcccgatatt gcctatccat acttattcaa ttatgtaaaa      1860
     ggggaagagt atcgaacaca gaaaatggtt cgcgatctat taaaaaaaca cttcaaaaac      1920
     agtcctgatg gcattcctgg caacgacgat acaggtacga tgtcttcgtg ggccgtatta      1980
     tcaatgatgg ggatttatcc cgttaatcca tctgaagcat cttatgcgat tacgaaacct      2040
     aaattcgata aaatcacaat gcatctagat gacgaatact acaatggaaa aaccttggaa      2100
     atcaaaacga aaagggaatc taacaaagaa gctataagaa atatcatgat tgatggtaaa      2160
     gctcataaag ggtattttat tgagcatcaa aaattggtaa aggcatcagt aattaccatt      2220
     gattaa                                                                 2226
//

If you have problems or comments...

PBIL Back to PBIL home page