(data stored in ACNUC7421 zone)

EMBL: CP002157.PE546

CP002157.PE546       Location/Qualifiers
FT   CDS_pept        complement(586976..587938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01422"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01422"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99992"
FT                   /db_xref="InterPro:IPR007184"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVR2"
FT                   /protein_id="EAQ99992.1"
FT                   /translation="MKLPWQDRPDNCDDVLWRFSENPIINRNDIPSSNSIFNSAVVPYK
FT                   DGYAGVFRCDNKAVQMNIFAGFSKDAIHWEINHEPIVMQEGNTPMIESDYKYDPRVVFI
FT                   EDRYWITWCNGCHGPTIGIAYTFDFKEFFQCENAFLPFNRNGVLFPSKIGGRYAMLSRP
FT                   SDNGHTPFGDIYVSFSPDMKYWGEHRCVMKVTPFEESAWQSCKIGAGTVPFMTDEGWLM
FT                   FYHGVINTCNGFRYSIGSAILDANEPDKVKYRTQPYLLAPTELYEQVGDVPNVVFPCAA
FT                   LHSLEEDKVAVYYGAADTAVAMAFGRISEIIEFTKKNSI"
     atgaaattac cttggcaaga tagacctgat aattgtgatg atgtgctttg gcgtttttca        60
     gaaaacccaa tcataaatag aaacgatata ccatcatcga acagtatttt taatagtgct       120
     gttgtaccat ataaagatgg gtatgcagga gtttttagat gtgataacaa agcagtgcaa       180
     atgaatattt ttgcgggctt tagtaaagat gcaatccatt gggaaatcaa tcacgaaccc       240
     attgtaatgc aagagggaaa taccccaatg atcgagtccg attataaata tgacccacgt       300
     gtggttttta ttgaagatcg gtattggatt acttggtgta acggctgtca tggtccaacc       360
     attggtatcg cttatacttt tgattttaag gagttttttc agtgtgagaa cgcctttttg       420
     cccttcaata gaaatggggt tttattccct tcaaaaattg gcggaagata cgctatgcta       480
     agtagaccca gtgataatgg tcatacacct tttggagata tttatgtgag ttttagtcca       540
     gatatgaaat actggggtga acatagatgt gtaatgaaag tcactccttt cgaggaaagt       600
     gcatggcaaa gttgcaaaat cggtgccggt acggttccgt ttatgaccga cgagggttgg       660
     ttaatgttct atcatggggt aataaataca tgtaacggat ttagatactc aatagggtct       720
     gccattcttg atgcaaatga acctgataag gttaaataca gaacacaacc ttatctttta       780
     gcacctacag aactatatga gcaagtaggt gatgttccta acgtagtatt tccgtgtgca       840
     gcactacatt ctttagaaga agataaagtg gcagtatatt atggtgcggc cgatacggca       900
     gtagcaatgg cattcggacg tatttctgaa attatagaat tcacaaagaa aaatagcatt       960
     taa                                                                     963
//

If you have problems or comments...

PBIL Back to PBIL home page