(data stored in ACNUC7421 zone)

EMBL: CP002157.PE549

CP002157.PE549       Location/Qualifiers
FT   CDS_pept        592312..593397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01437"
FT                   /product="putative two-component system sensor protein,
FT                   without kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01437"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99995"
FT                   /db_xref="GOA:A4AVR5"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVR5"
FT                   /protein_id="EAQ99995.1"
FT                   /translation="MRINERLDDILSGDEPKGYEISYKHHIVFWLIYFAFNALRWGSVH
FT                   DDLIYSLKTNLIGFPIHIALSYFNVYYLMPKFVFQKKYFTYALLIFISLGVMLLVKFNL
FT                   TYYFISTNVMPEADEIVNTLTLNYAITTMLGELYVVSFVTAIKITADWLQENNKFHNLE
FT                   KRQLTTELKFLRSQVSPHFFFNTLNNIYSLTLEKSDKAPEVVLKLSELMRYLLYATKKP
FT                   KQNLKNEIDCIQNYIDLERIRFDDSLEVNMQISGDLENKKIAPMLLIPLIENCFKHGAS
FT                   KNIGKMHIDVDISVKEDFLYFNVSNTVPEKRKKEKSEKKIGGIGLSNVKKRLELGYGKN
FT                   EYDLKISELDKKFHVELKLKV"
     atgcggataa atgaaagatt agatgatata ttaagtggtg acgaaccaaa aggatatgaa        60
     atatcatata aacaccacat tgttttttgg cttatttatt ttgcattcaa cgcactcaga       120
     tggggaagcg ttcatgatga tttaatatat tctttaaaga ccaatctcat tggttttcca       180
     attcatattg ccctctccta tttcaatgtg tattacttaa tgcccaaatt cgtatttcaa       240
     aaaaaatact tcacctatgc ccttttaatc tttatatcac ttggggttat gcttttggta       300
     aaattcaacc tcacctatta ttttattagt accaatgtaa tgcccgaggc cgatgaaatt       360
     gttaataccc ttaccttaaa ttatgctatc accacaatgc tgggtgagct atatgtggtc       420
     tcgtttgtta cggccattaa aataactgcg gactggttac aagaaaacaa taagtttcat       480
     aaccttgaaa aacgacaatt gacaaccgaa cttaaatttt taaggtctca ggtttctcca       540
     cattttttct tcaatacact caacaatatt tattcattaa cgcttgaaaa gtcagataaa       600
     gcaccggaag tggtcttaaa actttctgag cttatgcggt atcttttata tgccacaaaa       660
     aagccaaaac aaaacctgaa aaatgaaata gactgtattc agaactatat tgaccttgag       720
     cgtatacgct ttgatgattc gttagaggtg aatatgcaga tttctggcga tttagagaat       780
     aaaaaaatag cgccaatgtt gctgattcct cttattgaaa actgcttcaa acatggggcc       840
     agcaaaaata ttggtaaaat gcatattgat gttgatatca gtgttaaaga agattttctg       900
     tattttaatg tctcgaatac ggtacctgag aaaagaaaaa aagaaaaatc tgaaaaaaaa       960
     attgggggta ttgggctttc caatgtaaag aaaagactcg aattgggtta tggtaaaaat      1020
     gagtatgacc ttaaaatttc ggaattggat aaaaaatttc atgttgaatt aaaactaaaa      1080
     gtataa                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page