(data stored in ACNUC7421 zone)

EMBL: CP002157.PE550

CP002157.PE550       Location/Qualifiers
FT   CDS_pept        593397..594113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01442"
FT                   /product="two-component system response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01442"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99996"
FT                   /db_xref="GOA:A4AVR6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVR6"
FT                   /protein_id="EAQ99996.1"
FT                   /translation="MELKVIIIDDEPLAINVLKNYIQQIKELELVNSFSNAVDAYSFLQ
FT                   ENEIDIIFLDIHMPILDGLEFLKTLQDAPMVVITTAHEEFALESYDLEVIDYLVKPIPF
FT                   PRFMKAVNRIMKLKQMNHSNDRNGPHDHPSIFVKVDKKKLQKIYLDEIIVVESLKDYIR
FT                   IKTTTGKYIIHKTLTSFTDELPSDQFIRIHRSFTISIDKVQVVEGNSVEIDNTRYTIGR
FT                   SYLNDVKSKILNNSIS"
     atggaattga aagtgataat tattgacgat gaaccattgg caataaacgt gctaaagaac        60
     tacattcaac aaatcaagga attagagctt gtaaattcat tttccaacgc ggtggatgcc       120
     tattcattct tgcaagagaa tgaaattgat atcatatttc ttgatattca tatgccaatt       180
     ttggatgggt tggaattctt aaaaaccctg caagatgcgc ctatggtggt tattaccact       240
     gcccatgaag aatttgccct ggagagttat gatcttgagg ttatcgacta tttggttaaa       300
     cctattccct ttccaagatt catgaaagct gtgaacagaa tcatgaaatt gaagcagatg       360
     aaccattcga atgatagaaa tggcccacat gatcacccaa gtatatttgt aaaagttgac       420
     aaaaagaagt tgcaaaaaat ctatttggat gaaatcatag tggtcgaaag ccttaaagat       480
     tatatccgaa ttaaaaccac cacaggtaaa tatataattc acaaaacgct cactagcttt       540
     accgacgaat taccatcaga tcaattcatc aggatacaca gatcattcac aatttccatt       600
     gataaagtac aggttgttga gggtaatagc gttgagatag acaacaccag gtacacgatt       660
     ggtagaagtt acctcaatga tgtaaaaagt aagatattga ataactccat ttcctaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page