(data stored in ACNUC7421 zone)

EMBL: CP002157.PE552

CP002157.PE552       Location/Qualifiers
FT   CDS_pept        596650..598143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01452"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01452"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99998"
FT                   /db_xref="GOA:A4AVR8"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVR8"
FT                   /protein_id="EAQ99998.1"
FT                   /translation="MSEKKILEERSLILNRRSFLGKTALGVGGVALASLLGTNFFRKSE
FT                   NGILTADGGPAGVNGILNSLHHPAKIKRVIYLFQSGGPSQLELFDYKPLLNKRRGEDLP
FT                   ESIRNGQRLTGMTSGQDKFPLVGSQFGFQQHGKNGTWISDILPYTAKMADDICVINSMY
FT                   TEAINHDPAVTFFQTGSQQPGRPSIGSWLSYGLGSENENLPAFTVLLSRGTGRPNGQPL
FT                   YTRLWGNGFLHSLHQGVQFRAAKDPVLYLNDPDGISKKSKRDMLDQIAELNDKHFQESG
FT                   DPEIQSRIAQYEMAYRMQTSVPDVINTDKEPDYIYKMYGADAKIPGTYAANCLLARRLA
FT                   EQDVRFIQLYHMGWDQHDNLPGAIERQAKDTDQASAALIADLKQRGMLEDTLVIWGGEF
FT                   GRTNYSQGVLTDTNYGRDHHPRCFSMWMAGGGIKPGIVYGETDDFGYNITRNPVHVHDF
FT                   QATLLHQLGINHEKLTYKYQGRRFRLTDVEGHVIKDILT"
     atgagtgaga agaaaattct tgaagaacgg tctttgattc taaaccgtag atcattttta        60
     ggtaaaaccg ccctgggtgt tggtggtgtt gctttagctt ctctcttggg aaccaacttt       120
     ttcagaaaaa gtgaaaatgg catcttaaca gctgatggtg gacctgcagg agttaacggt       180
     atattgaact ccctacatca cccagctaaa ataaaaaggg taatctatct atttcaaagt       240
     ggaggcccat cccaattgga attgtttgat tacaaaccac tattgaacaa aagacgtggt       300
     gaagatctgc cagaatccat aagaaatggg caacgattaa caggcatgac ctccggtcaa       360
     gataaattcc cactggtggg atcacaattt ggttttcaac agcatggcaa gaatggcaca       420
     tggatcagcg acatattgcc ctacacggct aaaatggccg atgatatttg cgtcatcaac       480
     tcaatgtaca ctgaggccat taaccatgat ccggctgtga ctttcttcca aacaggttct       540
     cagcaaccgg gaagacccag tattggctct tggttgagct atggtttagg cagcgaaaac       600
     gaaaaccttc cggcatttac ggtattgtta tcacggggta cgggtaggcc aaacggtcaa       660
     cctttatata cccgactttg gggcaatggt tttttacatt cattgcacca aggcgttcaa       720
     ttcagggctg caaaagaccc tgtactttat ctgaatgacc cagatggtat ttcaaagaaa       780
     agcaaacgcg atatgctgga tcaaatcgcc gagttgaacg acaaacattt tcaagaaagt       840
     ggtgaccccg aaatacagag cagaatcgcg caatatgaaa tggcgtatcg tatgcagact       900
     tcggtccctg atgtaataaa tacagataaa gagccagatt atatttacaa aatgtacggt       960
     gccgatgcca aaattcccgg tacttatgca gcaaactgtt tattggctag aagattggca      1020
     gaacaggacg ttcgttttat tcagttgtac catatgggct gggaccaaca tgacaacctt      1080
     cccggtgcca ttgagcggca ggcaaaagat actgatcaag cctcagctgc attgatcgcc      1140
     gatttaaaac aacgtggaat gctcgaagat actttggtta tctggggcgg cgaatttggt      1200
     cgtaccaatt attcacaagg tgttttgacc gataccaatt atggtcgcga ccaccatcca      1260
     agatgcttta gtatgtggat ggccggcggc ggaataaaac cgggcattgt ttatggcgaa      1320
     actgatgatt ttggttataa tattacgaga aacccagttc atgtacatga ttttcaggct      1380
     acgcttttgc atcagcttgg tataaaccat gaaaaactaa cgtataaata tcaaggaaga      1440
     cgctttagat tgacagatgt tgaagggcat gtgataaaag acatccttac ttaa            1494
//

If you have problems or comments...

PBIL Back to PBIL home page