(data stored in ACNUC7421 zone)

EMBL: CP002157.PE553

CP002157.PE553       Location/Qualifiers
FT   CDS_pept        598154..599188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="FB2170_01457"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:FB2170_01457"
FT                   /db_xref="EnsemblGenomes-Tr:EAQ99999"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:A4AVR9"
FT                   /protein_id="EAQ99999.1"
FT                   /translation="MNRRNFIQNTSLASGGLLAGMPILNAMAPFKDVIIGHNSHQYKID
FT                   MNWGALNSNFYPVNDCHEMVQDSKGRIILLTNHTKNNVIVYDKSGKLIEVWGTDYPGAH
FT                   GLTLNVENGEDVLYISDNARHEVIKTTIDGKVIQVFTYPKESGKYDKKELYVPTETAIA
FT                   ANGDVYIADGYGEQFIMHYNAKGELLNTFGGKGEEDEKFNNAHGICIDTRNPSDPTLLI
FT                   TARQQNKLKRFTMDGKFIESSDLPGAYICRPVIHGTNVYLATIWSGDGSENTGFVSVLD
FT                   KDNKLISAPGGSTPNYVDGTLEHMHQTAKIFHHPHDVCVDDDENLYVAQWNSGKTYPIK
FT                   LFRV"
     atgaatcgaa gaaactttat ccaaaatact tccttagcct ccggagggct ccttgccgga        60
     atgcccattt taaatgccat ggcacctttt aaagatgtaa tcattggtca taattcacat       120
     caatataaaa tagatatgaa ttggggagcg ttgaattcaa atttctaccc agtgaatgac       180
     tgccatgaaa tggttcagga ttccaaagga cgcatcattc ttttgaccaa tcacaccaaa       240
     aacaatgtca ttgtatatga caaatcggga aaattgattg aagtctgggg aaccgattat       300
     cccggtgccc atggactcac attaaatgtt gaaaatggcg aagatgtact ttacatttcg       360
     gacaatgcca gacatgaggt cattaaaacg accattgatg gcaaggtaat acaggtattt       420
     acctatccaa aagaatcggg taagtatgat aaaaaagaac tgtacgtgcc aaccgagact       480
     gcgattgcag caaatggcga tgtatatata gccgatggtt acggtgagca attcatcatg       540
     cattataacg ccaaagggga attattgaac acctttggtg gtaaaggtga ggaagatgaa       600
     aaattcaaca atgcacacgg tatctgtatt gatacccgaa acccatccga cccaaccctg       660
     ttgattacgg ctagacagca gaacaaactc aaaagattta ccatggatgg taagttcatt       720
     gaaagctcag atttaccggg cgcttatatc tgtaggcctg taatacatgg taccaatgtg       780
     tatttggcca cgatttggtc tggcgatggt agtgaaaata ctggtttcgt ttctgtgctg       840
     gacaaggata acaaattaat ttctgcacct ggtggaagta caccaaatta tgttgacggc       900
     accttggaac atatgcacca aacagccaag atttttcacc atccgcatga tgtgtgtgtt       960
     gatgatgatg aaaacctata tgtcgcacaa tggaattctg ggaaaacata tcctataaaa      1020
     ttgttcaggg tgtaa                                                       1035
//

If you have problems or comments...

PBIL Back to PBIL home page